DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and zig-3

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:247 Identity:49/247 - (19%)
Similarity:83/247 - (33%) Gaps:70/247 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 AQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHIL 160
            |.||:|:.|..:...|:......::|...:.|:|  |....|.|.|.......:.|  .:||..:
 Worm    24 AAVSNLVREIDSTHLTTKPSLKIIEGLEDNTVST--GESVTLRCDVLSTPTGVIYW--EKDGQRI 84

  Fly   161 TVDRAVFIADQRFLAIKQPDKYWTL----QIKYVQARDAGSYEC-------------QVSTEPKV 208
            ..|:.:.:.::...|:....:...:    ||........|||:|             ::|.|.:.
 Worm    85 QGDKELNVFEKVLNAMGPTVESGIITSSYQIPCANLHHIGSYKCVATNGHDTVESSAKISVEGQT 149

  Fly   209 ----SARVQLQVVVPRTE-----------ILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHG 258
                |.|....|:...||           ::...||  :|..|                  |...
 Worm   150 VKCKSTRRSAPVITMSTESRFELQDNAATLICRADR--RANWN------------------WMFE 194

  Fly   259 AEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSN 310
            .:::..||.|:..     ||.         |.|:|...:..|.|:|.|...|
 Worm   195 DKKIDFDSGRYEL-----LPS---------GDLLIRKIQWSDMGSYFCIAHN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 21/111 (19%)
Ig 127..217 CDD:299845 21/110 (19%)
IG_like 227..320 CDD:214653 18/84 (21%)
IGc2 234..311 CDD:197706 15/77 (19%)
zig-3NP_509336.1 I-set 45..145 CDD:254352 18/103 (17%)
Ig 61..142 CDD:143165 14/82 (17%)
IG_like 177..244 CDD:214653 18/90 (20%)
Ig <191..237 CDD:299845 14/56 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.