DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and zig-2

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:240 Identity:49/240 - (20%)
Similarity:71/240 - (29%) Gaps:92/240 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SNVTTQIGTHAYLPCRVKQLGNKSVSW----IR-------------LRDGHILTVDRAVFIADQR 172
            ||||  .|....|.|........|:.|    :|             |.||.  .|..|..::.. 
 Worm    42 SNVT--FGEKFVLSCGANGAPLPSIYWELNGMRIQGEETSNVYENILNDGK--QVSNAAMVSSH- 101

  Fly   173 FLAIKQPDKYWTLQIKYVQARDAGSYECQVST--------------------------EPKVSAR 211
                        .:|....||::|:|:|.:..                          .|.:|..
 Worm   102 ------------YRIPCATARNSGAYKCIIDNGLTKLEHVAKVFVGGNKTNCALNDNGAPFISMT 154

  Fly   212 VQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPN 276
            |..     |.||         :.:.|.|.|    ..|..|...|:.|.:.|..|..|:  |:.|:
 Worm   155 VDF-----RLEI---------SNNAVALSC----RSETATEWSWHKGEQLLTNDGERY--QMFPS 199

  Fly   277 LPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNII 321
                        |.|||.:....|.|.|.|:..|....|..:..:
 Worm   200 ------------GDLIIRNISWSDMGEYNCTARNHFGETTAITFL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 24/133 (18%)
Ig 127..217 CDD:299845 22/132 (17%)
IG_like 227..320 CDD:214653 22/92 (24%)
IGc2 234..311 CDD:197706 20/76 (26%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 21/108 (19%)
Ig 34..121 CDD:299845 21/95 (22%)
Ig <179..232 CDD:299845 17/66 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.