DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and zig-10

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:85 Identity:26/85 - (30%)
Similarity:32/85 - (37%) Gaps:8/85 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 DRYVKAGSNVVLRCIVRGALEPPTF--IMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGS 290
            :|.|..||...|.|      ||.|.  :.||.....:|.........|:...|....|....||.
 Worm    33 ERLVPIGSTTALEC------EPYTSSNVTWYRDKHVIATVEGHKNAILNERKPRGGEERIPEIGF 91

  Fly   291 LIIESAKKRDTGNYTCSPSN 310
            |:|...:|.|.|||.|...|
 Worm    92 LVIFDVQKEDEGNYYCQREN 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352
Ig 127..217 CDD:299845
IG_like 227..320 CDD:214653 26/85 (31%)
IGc2 234..311 CDD:197706 24/79 (30%)
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 26/85 (31%)
IGc2 38..111 CDD:197706 23/78 (29%)
IG_like 143..215 CDD:214653
IGc2 145..209 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.