Sequence 1: | NP_001262320.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509155.1 | Gene: | rig-3 / 180958 | WormBaseID: | WBGene00004370 | Length: | 487 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 40/203 - (19%) |
---|---|---|---|
Similarity: | 70/203 - (34%) | Gaps: | 50/203 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 108 LSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQR 172
Fly 173 FLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEPDRYVKAGSNV 237
Fly 238 VLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTG 302
Fly 303 NYTCSPSN 310 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr11 | NP_001262320.1 | I-set | 125..216 | CDD:254352 | 13/90 (14%) |
Ig | 127..217 | CDD:299845 | 14/89 (16%) | ||
IG_like | 227..320 | CDD:214653 | 19/84 (23%) | ||
IGc2 | 234..311 | CDD:197706 | 17/77 (22%) | ||
rig-3 | NP_509155.1 | IG_like | 48..142 | CDD:214653 | |
Ig | 267..341 | CDD:319273 | 17/74 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |