DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and rig-3

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_509155.1 Gene:rig-3 / 180958 WormBaseID:WBGene00004370 Length:487 Species:Caenorhabditis elegans


Alignment Length:203 Identity:40/203 - (19%)
Similarity:70/203 - (34%) Gaps:50/203 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQR 172
            :..|:|..|| ||    ..:.|..|..|.:....|:....:||.|        |::.....:.:.
 Worm   179 IQMTNGNGEP-LD----EEIWTIAGNEATIDSLKKEHAELTVSCI--------TIEMHQETSKEE 230

  Fly   173 FLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEPDRYVKAGSNV 237
            |..:.:.|                 ...:|.|.|:......:|..|        .|.:|:   :.
 Worm   231 FPVVDRKD-----------------VNIEVYTLPEFETEESVQYTV--------IDNHVR---DA 267

  Fly   238 VLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTG 302
            ::.|.|..:..|.....:|||.|::....   :..:..|:      |.|....|.|.:..:.|.|
 Worm   268 IIYCNVTHSFPPVRHYTFYHGDEEIKMSD---KFNIFVNV------GVSQGAHLKIHNVNENDLG 323

  Fly   303 NYTCSPSN 310
            .|.|..:|
 Worm   324 TYKCEANN 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 13/90 (14%)
Ig 127..217 CDD:299845 14/89 (16%)
IG_like 227..320 CDD:214653 19/84 (23%)
IGc2 234..311 CDD:197706 17/77 (22%)
rig-3NP_509155.1 IG_like 48..142 CDD:214653
Ig 267..341 CDD:319273 17/74 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.