DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and igcm-2

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001362087.1 Gene:igcm-2 / 180913 WormBaseID:WBGene00020130 Length:802 Species:Caenorhabditis elegans


Alignment Length:239 Identity:56/239 - (23%)
Similarity:89/239 - (37%) Gaps:64/239 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQP--------DKYWTLQIK 188
            |....|||.:.....:|.|....:||.::.   :.|..:|..:.   |        |.:..:.|.
 Worm    28 GAPITLPCSISLFNEESFSLDWRKDGQLIL---SAFGQEQGHVT---PTLQGRLARDGFLGITIH 86

  Fly   189 YVQARDAGSYECQVS------TEPKVSARVQLQVVVPRTEILGEPDR----YVKAGSNVVLRCIV 243
            .|...|||.|:|.|:      |.|:.....:|.|.||  .::..|.:    :.|.|::::..|..
 Worm    87 SVTDGDAGVYQCIVT
KFSKQPTRPEKGLSAKLVVNVP--PVIISPSKNAIIHKKVGADLIFECKA 149

  Fly   244 RGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSP 308
            .||..|.  |.|... ||:.                      ||...|.:.:.::.|.|.|||..
 Worm   150 EGAPSPE--ITWSRN-EQII----------------------STSPVLTLSNLEEGDKGLYTCLA 189

  Fly   309 SNSPSATVTLNIINGESSASAVTSSAATTRAYALSILALLLSVI 352
            .|          |.|.|::|.   ....|:|..|.::.|..:||
 Worm   190 VN----------IEGNSTSSI---DVRFTKATILDLIPLNKTVI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 23/97 (24%)
Ig 127..217 CDD:299845 23/98 (23%)
IG_like 227..320 CDD:214653 20/96 (21%)
IGc2 234..311 CDD:197706 17/76 (22%)
igcm-2NP_001362087.1 IG_like 23..101 CDD:214653 19/78 (24%)
Ig 124..200 CDD:386229 23/110 (21%)
IG_like 214..298 CDD:214653 3/7 (43%)
Ig_3 309..371 CDD:372822
Ig 389..467 CDD:386229
FN3 476..548 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.