DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Ncam1

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:180 Identity:45/180 - (25%)
Similarity:68/180 - (37%) Gaps:27/180 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 IGTHAYLPCRVK-QLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARD 194
            :|...:..|:|. ...:|.:||.. .:|..|:.::      ||...:...|...||.|......|
Mouse    33 VGESKFFLCQVAGDAKDKDISWFS-PNGEKLSPNQ------QRISVVWNDDDSSTLTIYNANIDD 90

  Fly   195 AGSYECQVSTEPKVSARVQLQVVVPRTEILGE---PDRYVKAGSNVVLRCIVRGALEPPTFIMWY 256
            ||.|:|.|:.|....:...:.|.:.:..:...   |..: |.|.:.|:.|.|..:| ||| |:|.
Mouse    91 AGIYKCVVTAEDGTQSEATVNVKIF
QKLMFKNAPTPQEF-KEGEDAVIVCDVVSSL-PPT-IIWK 152

  Fly   257 HGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTC 306
            |....:..........|..|.             |.|...||.|.|.|.|
Mouse   153 HKGRDVILKKDVRFIVLSNNY-------------LQIRGIKKTDEGTYRC 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 21/85 (25%)
Ig 127..217 CDD:299845 21/86 (24%)
IG_like 227..320 CDD:214653 23/80 (29%)
IGc2 234..311 CDD:197706 21/73 (29%)
Ncam1XP_006510118.1 Ig1_NCAM-1 20..115 CDD:143273 22/88 (25%)
IG 124..190 CDD:214652 23/82 (28%)
Ig3_NCAM-1_like 211..308 CDD:143207
Ig_NCAM-1 307..413 CDD:143277
Ig_3 417..494 CDD:372822
FN3 509..606 CDD:238020
fn3 649..731 CDD:365830
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.