DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and zig-8

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:229 Identity:56/229 - (24%)
Similarity:96/229 - (41%) Gaps:29/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 AYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYE 199
            |||.|.|.......::|.|:.||.:||.....|..|.|:...|:....|.|.::..:.:|:|.|.
 Worm    53 AYLHCSVPPDAEHEIAWTRVSDGALLTAGNRTFTRDPRWQVSKKSANIWVLNLRRAEQQDSGCYL 117

  Fly   200 CQVSTEPKVSARVQLQVVVPRTEILGEPDRYVK---------AGSNVVLRCIVRGA--LEPPTFI 253
            |:::.:......|.|:|:.|.   |..|....|         :|..|||.|.|...  .|....:
 Worm   118 CEINDKHNTVYAVYLKVLEPP---LPSPSSLQKKSTKLMANMSGDEVVLNCTVTSTDKDEEVLDV 179

  Fly   254 MWYHGAEQL-AADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVT 317
            :|......: ..|:.::       :.:...:....|.::.|..|...|.|||.|..|...::.: 
 Worm   180 VWTRDGNTINFNDTEKY-------ILKVKRDAGVVIETMRIRKATMEDDGNYACEHSQQKASQI- 236

  Fly   318 LNIINGESSASAVTSSAAT--TRAYALSILALLL 349
            ::|    :.|.|.||::||  ...:::||....|
 Worm   237 VHI----NKAEAQTSNSATFPCSIFSISIFMYFL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 23/80 (29%)
Ig strand B 135..139 CDD:409353 3/3 (100%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 2/3 (67%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 20/104 (19%)
Ig strand B 237..241 CDD:409544 3/3 (100%)
Ig strand C 252..256 CDD:409544 0/3 (0%)
Ig strand E 289..293 CDD:409544 0/3 (0%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
zig-8NP_499714.1 Ig strand B 53..57 CDD:409353 3/3 (100%)
IG_like 55..134 CDD:214653 21/78 (27%)
Ig strand C 66..72 CDD:409353 1/5 (20%)
Ig strand E 101..105 CDD:409353 2/3 (67%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig 158..238 CDD:472250 18/87 (21%)
Ig strand B 161..165 CDD:409353 3/3 (100%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand F 223..228 CDD:409353 3/4 (75%)

Return to query results.
Submit another query.