DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and nitr1d

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_938163.1 Gene:nitr1d / 170990 ZFINID:ZDB-GENE-020225-11 Length:324 Species:Danio rerio


Alignment Length:207 Identity:45/207 - (21%)
Similarity:78/207 - (37%) Gaps:47/207 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 IKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEPDR----------Y 230
            :.:.|.|:.|.|...:..|:.:|.|.||:..........:::| |.|   ..||          .
Zfish    87 VNKGDFYFNLTIVKTKPSDSATYYCVVSSYQATGMGSGTRLLV-R
DE---AADRNTTLHQSLIDA 147

  Fly   231 VKAGSNVVLRC-IVRGALEPPTFIMWYHGAEQLAADS------RRHRTQLDPNLPEASGEGQSTI 288
            |..|.:|.|:| |...:......:.|:   :|.:.||      :..|.....|..|:  :.||.:
Zfish   148 VDPGDSVHLQCSIFTESCAGDHRVYWF---KQSSGDSEGVLYTKGERNGRCKNSTES--QTQSCV 207

  Fly   289 GSLIIESAKKRDTGNYTCSPSNSPSATV----TLNI-----INGESSASAVTSSAATTRAYALSI 344
            .||...:..:.|:|.|.|:.:......:    .|||     .|....||.:|:            
Zfish   208 YSLHKNNISRSDSGIYYCAVAACGEILLGRGTQLNIKERCDFNPALLASGITN------------ 260

  Fly   345 LALLLSVILIGV 356
            :..|..|:.:|:
Zfish   261 IVFLALVVFLGI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 9/39 (23%)
Ig 127..217 CDD:299845 9/40 (23%)
IG_like 227..320 CDD:214653 24/113 (21%)
IGc2 234..311 CDD:197706 20/83 (24%)
nitr1dNP_938163.1 Ig 35..130 CDD:299845 10/43 (23%)
IG_like 59..129 CDD:214653 9/41 (22%)
IG_like 148..227 CDD:214653 21/83 (25%)
V-set 150..243 CDD:284989 21/97 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.