DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and nitr1l

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_938161.2 Gene:nitr1l / 170986 ZFINID:ZDB-GENE-020225-7 Length:316 Species:Danio rerio


Alignment Length:284 Identity:63/284 - (22%)
Similarity:108/284 - (38%) Gaps:58/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ASALSATSGLVEPYLDGYATSNV-TTQIGTHAYLPCRVKQLGNKSVSWIR-LRDGHILTV----- 162
            :|.:..:||     |:....:|| ....|....|.|...:|...:.:|.: ..||..|.:     
Zfish    10 SSTIFCSSG-----LEVVQENNVKIAAAGEEVNLTCTFIRLVQATKAWFKQTADGKSLQIVSLYS 69

  Fly   163 -DRAVF--IADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVST----EPKVSARVQLQVVVPR 220
             .:.|:  |::..|..:| .|.|:.|.|...:..|:.:|.|.:||    ......|:.::.....
Zfish    70 NGKPVWSNISENHFNVMK-GDGYFNLTILKTKPSDSATYYCVISTFYTFGMGSGTRLLVRAADRN 133

  Fly   221 TEILGEPDRYVKAGSNVVLRC-IVRGALEPPTFIMWYHGAEQLAADS---------RRHRTQLDP 275
            |.:.......|..|.:|.|:| |...:.|....|.|:   :|.:.||         |..|.:   
Zfish   134 TTLHQSLIDTVDPGDSVNLQCSIFTESCEGDHSIYWF---KQSSGDSEGVLYTKGERNGRCK--- 192

  Fly   276 NLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATV----TLNI----INGESSASAVTS 332
              .....:.||.:.||...:..:.|:|.|.|:.:......:    .|||    .|....||.:|:
Zfish   193 --DSTESQTQSCVYSLHKNNISRSDSGIYYCAVATCGQILIGRGTQLNIRESDFNPALLASGITN 255

  Fly   333 SAATTRAYALSILALLLSVILIGV 356
                     :..|||   |:.:|:
Zfish   256 ---------VIFLAL---VVFLGI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 24/104 (23%)
Ig 127..217 CDD:299845 23/103 (22%)
IG_like 227..320 CDD:214653 23/106 (22%)
IGc2 234..311 CDD:197706 21/86 (24%)
nitr1lNP_938161.2 V-set 30..128 CDD:311561 22/98 (22%)
V-set 143..240 CDD:311561 24/104 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.