DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Papln

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001192272.1 Gene:Papln / 170721 MGIID:2386139 Length:1302 Species:Mus musculus


Alignment Length:326 Identity:77/326 - (23%)
Similarity:106/326 - (32%) Gaps:103/326 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 HTQTSAEAAGGRVSGPGAGTSEGAGTSSASAASTAISSDESGDPSSATAFSSLAQVSSLLPEASA 107
            |..|.|||.|.||..|                         ..|..||...              
Mouse  1041 HRGTGAEAGGHRVLSP-------------------------SHPRPATRLR-------------- 1066

  Fly   108 LSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQR 172
                       ||......|....|....|.||.:.....::.|  .|||.:::..|...     
Mouse  1067 -----------LDRTQPGVVDASPGQRIRLTCRAEGFPVPTIEW--QRDGQLVSSPRHQV----- 1113

  Fly   173 FLAIKQPDKYWTLQIKYVQARDAGSYEC-QVSTEPKVSARVQLQVVVPRTEILGEPDRY-VKAGS 235
                 |||  .:|.|..|...|.|.|.| ..:.:.:....|||:|:...| |.|.|... |..|.
Mouse  1114 -----QPD--GSLVISRVDVEDGGYYSCVAFNGQDRDQRWVQLRVLRELT-ITGLPPAVTVAEGD 1170

  Fly   236 NVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRD 300
            ...|.|:|.|   ....|.|......:.||.  ||....|:            |:|:|.:.:.||
Mouse  1171 TARLLCVVAG---ESVNIRWSRNGLPIQADG--HRVHQSPD------------GTLLIHNLRPRD 1218

  Fly   301 TGNYTCSP---SNSPSATVTLNIINGESSASAVTSSAATTRAYA--------LSILALLLSVILI 354
            .|:||||.   |.:.|.:..:.:        |:.:.||.:|...        |:..||:|...|.
Mouse  1219 EGSYTCSAFRGSQAVSRSTEVKV--------ALPAPAAQSRDLGKDCIDQPELANCALILQAQLC 1275

  Fly   355 G 355
            |
Mouse  1276 G 1276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 23/91 (25%)
Ig 127..217 CDD:299845 23/90 (26%)
IG_like 227..320 CDD:214653 26/96 (27%)
IGc2 234..311 CDD:197706 23/79 (29%)
PaplnNP_001192272.1 TSP1 30..81 CDD:214559
ADAM_spacer1 184..299 CDD:368694
TSP1 309..362 CDD:214559
TSP1 389..447 CDD:214559
TSP1 447..504 CDD:214559
TSP1 511..562 CDD:214559
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 563..648
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 694..737
Kunitz_BPTI 771..822 CDD:333766
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 822..924
Papilin_u7 831..922 CDD:374683
Ig 932..>995 CDD:386229
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1024..1064 11/47 (23%)
I-set 1070..1141 CDD:369462 20/84 (24%)
Ig 1157..1241 CDD:386229 28/100 (28%)
PLAC 1257..1289 CDD:370061 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.