Sequence 1: | NP_001262320.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074739.2 | Gene: | Dscaml1 / 114873 | MGIID: | 2150309 | Length: | 2053 | Species: | Mus musculus |
Alignment Length: | 270 | Identity: | 71/270 - (26%) |
---|---|---|---|
Similarity: | 104/270 - (38%) | Gaps: | 55/270 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 LAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQ--------------IGTHAYLPCRVKQLG 145
Fly 146 NKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVS-TEPKVS 209
Fly 210 ARVQLQVVVPRTEILGEPDR----YVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRH- 269
Fly 270 -----RTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSASA 329
Fly 330 VTSSAATTRA 339 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr11 | NP_001262320.1 | I-set | 125..216 | CDD:254352 | 25/105 (24%) |
Ig | 127..217 | CDD:299845 | 25/104 (24%) | ||
IG_like | 227..320 | CDD:214653 | 30/102 (29%) | ||
IGc2 | 234..311 | CDD:197706 | 25/82 (30%) | ||
Dscaml1 | NP_001074739.2 | IGc2 | 43..110 | CDD:197706 | |
Ig | 125..218 | CDD:353325 | |||
I-set | 226..311 | CDD:336764 | |||
Ig_3 | 317..389 | CDD:339005 | |||
Ig | 408..498 | CDD:353325 | |||
IGc2 | 519..577 | CDD:197706 | 4/17 (24%) | ||
Ig | 615..681 | CDD:319273 | 19/74 (26%) | ||
Ig_DSCAM | 707..785 | CDD:143211 | 26/95 (27%) | ||
Ig | 803..891 | CDD:353325 | |||
FN3 | 887..981 | CDD:238020 | |||
FN3 | 988..1085 | CDD:238020 | |||
FN3 | 1093..1186 | CDD:238020 | |||
FN3 | 1191..1282 | CDD:238020 | |||
Ig | 1307..1377 | CDD:319273 | |||
FN3 | 1384..1474 | CDD:238020 | |||
FN3 | 1488..1560 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1716..1741 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1773..1803 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1840..1862 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1974..2053 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |