DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and LOC100909964

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_008767726.1 Gene:LOC100909964 / 100909964 RGDID:6500592 Length:308 Species:Rattus norvegicus


Alignment Length:227 Identity:52/227 - (22%)
Similarity:79/227 - (34%) Gaps:65/227 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 RAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYEC----QVSTEPKVSAR------------- 211
            |...|||    ..|:.:..::::|..:...|||:|.|    :.:.||.:..:             
  Rat    86 RITNIAD----VTKRNNTDFSIRISNIMLADAGTYYCVKFQKGTVEPDIEIQSGGGTELFVYGAD 146

  Fly   212 -VQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQL------------- 262
             .:|:||.|...|      .|.||.:|.|.|.|...: |...|.|:.||:..             
  Rat   147 MKKLKVVQPEKLI------SVDAGESVTLNCTVTSII-PMGPIKWFRGAQHSRHLIFNFTGGYFP 204

  Fly   263 ----AADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIING 323
                .:||.: |..||              .|:.|.:....|.|.|.|...........:.|.:|
  Rat   205 RVTNVSDSSK-RNNLD--------------FSIRISNVMPADAGTYYCVKFQKELLETDIEIQSG 254

  Fly   324 ESSASAV----TSSAATTRAYALSILALLLSV 351
            ..:...|    ||..|...|.||....|:|.:
  Rat   255 GGTELLVFEPKTSGIAKILAAALLGYKLMLRI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 14/69 (20%)
Ig strand B 135..139 CDD:409353
Ig strand C 148..152 CDD:409353
Ig strand E 183..187 CDD:409353 0/3 (0%)
Ig strand F 197..202 CDD:409353 2/8 (25%)
IG_like 227..320 CDD:214653 23/109 (21%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 1/3 (33%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
LOC100909964XP_008767726.1 Ig 32..142 CDD:472250 13/59 (22%)
Ig strand B 48..52 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 101..105 CDD:409353 0/3 (0%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 135..138 CDD:409353 0/2 (0%)
Ig 151..261 CDD:472250 29/131 (22%)
Ig strand B 167..171 CDD:409353 2/3 (67%)
Ig strand C 181..185 CDD:409353 1/3 (33%)
Ig strand E 220..224 CDD:409353 1/3 (33%)
Ig strand F 234..239 CDD:409353 2/4 (50%)
Ig strand G 254..257 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.