DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and LOC100909964

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_008767726.1 Gene:LOC100909964 / 100909964 RGDID:6500592 Length:308 Species:Rattus norvegicus


Alignment Length:227 Identity:52/227 - (22%)
Similarity:79/227 - (34%) Gaps:65/227 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 RAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYEC----QVSTEPKVSAR------------- 211
            |...|||    ..|:.:..::::|..:...|||:|.|    :.:.||.:..:             
  Rat    86 RITNIAD----VTKRNNTDFSIRISNIMLADAGTYYCVKFQKGTVEPDIEIQSGGGTELFVYGAD 146

  Fly   212 -VQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQL------------- 262
             .:|:||.|...|      .|.||.:|.|.|.|...: |...|.|:.||:..             
  Rat   147 MKKLKVVQPEKLI------SVDAGESVTLNCTVTSII-PMGPIKWFRGAQHSRHLIFNFTGGYFP 204

  Fly   263 ----AADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIING 323
                .:||.: |..||              .|:.|.:....|.|.|.|...........:.|.:|
  Rat   205 RVTNVSDSSK-RNNLD--------------FSIRISNVMPADAGTYYCVKFQKELLETDIEIQSG 254

  Fly   324 ESSASAV----TSSAATTRAYALSILALLLSV 351
            ..:...|    ||..|...|.||....|:|.:
  Rat   255 GGTELLVFEPKTSGIAKILAAALLGYKLMLRI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 14/69 (20%)
Ig 127..217 CDD:299845 14/70 (20%)
IG_like 227..320 CDD:214653 23/109 (21%)
IGc2 234..311 CDD:197706 21/93 (23%)
LOC100909964XP_008767726.1 V-set 35..142 CDD:284989 13/59 (22%)
IG_like 40..142 CDD:214653 13/59 (22%)
V-set 154..261 CDD:284989 27/128 (21%)
IG_like 159..238 CDD:214653 23/100 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.