DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and havcr2

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_003200921.2 Gene:havcr2 / 100536120 ZFINID:ZDB-GENE-091204-20 Length:231 Species:Danio rerio


Alignment Length:266 Identity:53/266 - (19%)
Similarity:82/266 - (30%) Gaps:100/266 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 YATSNVTTQ-----IGTHAYLPCR--VKQLGNKSVSW--------------------IRLRDGHI 159
            :||.:.:::     :|....|||:  :...|...|.|                    :..|:.|.
Zfish    14 FATCSESSKLVIGLVGDTVTLPCKYDINTNGPLGVCWGRHQSLFSCENTVISIDGLQLNYRESHR 78

  Fly   160 LTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEIL 224
            .::|..:...|.            :|.|:.||..|||.|.|                   |.|| 
Zfish    79 FSLDSGLDRGDV------------SLTIRAVQKSDAGMYVC-------------------RIEI- 111

  Fly   225 GEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIG 289
              |..:.....||.|  .:|..|:|...:    ...|||..:.:...|:     ....:..:.|.
Zfish   112 --PGLFNDISYNVYL--FIRSGLDPKRVV----SETQLAPTTAKQEKQV-----HLVSDSTTLIT 163

  Fly   290 SLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSASAVTSSA------ATTRAYAL-----S 343
            .|.:.|.|                 ..|.::..||..|.|.|...      .|.|..|:     .
Zfish   164 ELYLISEK-----------------MTTDDVRMGEVKAVAHTEETMETFIITTVRVGAIIFIPGL 211

  Fly   344 ILALLL 349
            |:||.|
Zfish   212 IIALFL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 20/117 (17%)
Ig 127..217 CDD:299845 20/116 (17%)
IG_like 227..320 CDD:214653 16/92 (17%)
IGc2 234..311 CDD:197706 14/76 (18%)
havcr2XP_003200921.2 V-set 19..109 CDD:284989 20/120 (17%)
IG_like 21..110 CDD:214653 21/119 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.