DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and cadm4

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_002939173.1 Gene:cadm4 / 100488420 XenbaseID:XB-GENE-992659 Length:394 Species:Xenopus tropicalis


Alignment Length:373 Identity:77/373 - (20%)
Similarity:110/373 - (29%) Gaps:136/373 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PSSATAFSSLAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVS 150
            |:.|.|.:.|.|...|   ...|.||:|.|  ........|||...|..|.:.|.:.|.      
 Frog     3 PALAPALALLQQRFVL---GIVLLATAGTV--VSQEVQAENVTVVEGGTAEISCHLHQY------ 56

  Fly   151 WIRLRDGHILTVDRAV----------FIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTE 205
                 ||.|:.:...|          .:.|.||..::...|...:.:...:..|.|.|.||:.||
 Frog    57 -----DGSIVVIQNPVRQTLFFNGTRALKDTRFQLVEFTQKVVKIHLSDAKLEDEGGYFCQLYTE 116

  Fly   206 PKVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQL-------- 262
            ........|.|:||....|.|.......|..:.|.|| .....|...:.||...::|        
 Frog   117 DTHHQIATLTVIVPPDNPLVEVKEQAVEGGEIELTCI-SPRTRPAATLRWYRDRKELKGFTSKQE 180

  Fly   263 -------------AADSRRHR-------------------------------------------- 270
                         :.|.:..|                                            
 Frog   181 NGKTFSITNSIRFSVDRKDDRDIVTCEASHPALKGQKKQTQYELDVQFSPTANIQPSQSLVREGD 245

  Fly   271 -------------------TQLDPNLPE-ASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSAT 315
                               |:|:.:||| |..:|.    .|...|...:|.|.|:|..||.    
 Frog   246 ELNLKCEVTGNPRPTEIIWTRLNDSLPERAQIQGD----VLSFPSLSLQDNGTYSCQVSNK---- 302

  Fly   316 VTLNIINGESSASAV--------TSSAATTRAYAL--SILALLLSVIL 353
                  :|.||...|        ...|.|...||:  .|||||:.:::
 Frog   303 ------HGRSSDQYVLVVYDPGAIIEAQTQVPYAVIGGILALLVFLVI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 23/100 (23%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 0/3 (0%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 25/177 (14%)
Ig strand B 237..241 CDD:409544 1/3 (33%)
Ig strand C 252..256 CDD:409544 0/3 (0%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
cadm4XP_002939173.1 IgI_2_Necl-4 128..226 CDD:409468 14/98 (14%)
Ig strand A 128..131 CDD:409468 1/2 (50%)
Ig strand A' 134..138 CDD:409468 1/3 (33%)
Ig strand B 146..156 CDD:409468 3/10 (30%)
Ig strand C 159..168 CDD:409468 3/8 (38%)
Ig strand C' 169..172 CDD:409468 0/2 (0%)
Ig strand D 174..181 CDD:409468 0/6 (0%)
Ig strand E 184..194 CDD:409468 0/9 (0%)
Ig strand F 202..210 CDD:409468 0/7 (0%)
Ig strand G 218..225 CDD:409468 0/6 (0%)
Ig_3 230..301 CDD:464046 13/74 (18%)
4.1m 350..368 CDD:128590
Ig 37..127 CDD:472250 23/100 (23%)
Ig strand B 47..51 CDD:409353 1/3 (33%)
Ig strand C 60..64 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 0/3 (0%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 120..123 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.