DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Sirpd

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_017446697.1 Gene:Sirpd / 100360722 RGDID:2321536 Length:308 Species:Rattus norvegicus


Alignment Length:200 Identity:50/200 - (25%)
Similarity:74/200 - (37%) Gaps:33/200 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 AIKQPDKYWTLQIKYVQARDAGSYEC----QVSTEPKVSAR--------------VQLQVVVPRT 221
            |.|:.:..:::.|..|...|||:|.|    :...||.:..:              .:|:|..|:.
  Rat    93 ATKRGNLDFSIHISNVTPADAGTYYCVKFQKGIVEPDIEIQSGGGTELSVFVADMKELKVFQPKK 157

  Fly   222 EILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGA---EQLAADSRRHRTQLDPNLPEASGE 283
            .:.      |.||.:|.|.|.|. :|.|...|.||.|.   ..|..:...:|.....|..:|:..
  Rat   158 SVC------VDAGGSVTLNCTVT-SLTPVGPIKWYRGVGHNRHLIYNFTGYRFPRVTNASDATKR 215

  Fly   284 GQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSASAV----TSSAATTRAYALSI 344
            |.... |:.|.:....|.|.|.|...........:.|.:|..:...|    ||..|...|.||..
  Rat   216 GNLDF-SIHISNVTPADAGTYYCVKFQKGIVEPDIEIQSGGGTELLVFELKTSHIAKILAAALIG 279

  Fly   345 LALLL 349
            ..|||
  Rat   280 CKLLL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 12/58 (21%)
Ig 127..217 CDD:299845 12/59 (20%)
IG_like 227..320 CDD:214653 24/95 (25%)
IGc2 234..311 CDD:197706 22/79 (28%)
SirpdXP_017446697.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.