DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and kirrel1b

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:246 Identity:61/246 - (24%)
Similarity:92/246 - (37%) Gaps:75/246 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 AQVSSLLPEASALSAT----SGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRD 156
            |..|.::.|...||..    :|:|:...||.|..                  :|....:|.|.|.
Zfish    32 ADQSVVIGERVVLSCVVFNYTGIVQWTKDGLALG------------------IGEDLRAWPRYRV 78

  Fly   157 GHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVP-- 219
            ..|:.|.:                  :.|:|......|...||||.:.....|.|.:|.|::|  
Zfish    79 LRIMDVGQ------------------YNLEITSADLTDDSLYECQATEAALRSRRAKLTVLIPPD 125

  Fly   220 RTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWY---------HGAEQLAADSRRHRTQLDP 275
            ...|.|.|:..:.||::..|.|:.||| :|.:.|.||         |.:.::.:|.:|..|:   
Zfish   126 GPVIEGSPEILLTAGTSFNLTCVSRGA-KPMSTIEWYKDGIIVEGAHTSTEVLSDRKRVTTK--- 186

  Fly   276 NLPEASGEGQSTIGSLIIESAKKRDTG-NYTCSPSN-----SPSATVTLNI 320
                          |.:.......||| |:||..||     ...:||||||
Zfish   187 --------------SFLEIQPMDTDTGRNFTCVASNLAAPLGKRSTVTLNI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 16/90 (18%)
Ig 127..217 CDD:299845 16/89 (18%)
IG_like 227..320 CDD:214653 29/107 (27%)
IGc2 234..311 CDD:197706 23/91 (25%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.