DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and ncam2

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_012811963.1 Gene:ncam2 / 100151722 XenbaseID:XB-GENE-1217730 Length:865 Species:Xenopus tropicalis


Alignment Length:188 Identity:50/188 - (26%)
Similarity:76/188 - (40%) Gaps:35/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SNVTTQIGTHAYLPCRVKQLGN-KSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIK 188
            |.|...:|...|..|.|  :|. .::.|...:...|        |:.||.:..::..:.| |.|.
 Frog    57 SKVEISVGQSKYFTCTV--IGEADNIDWFNPQGEKI--------ISGQRVVVQREGIRSW-LTIY 110

  Fly   189 YVQARDAGSYECQVSTEPK---VSARVQLQVVVPRT-EILGEPDRYVKAGSNVVLRCIVRGALEP 249
            .....|||.|.|| :|:.|   ..|.|.|::....| |.:..|..: |.|.|..:.|:|..:  |
 Frog   111 KANVDDAGIYRCQ-ATDSKGHAQEATVVLEIYQKLTFEDVPSPQEF-KRGENAEVLCLVSSS--P 171

  Fly   250 PTFIMWYHGAEQLA-ADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTC 306
            ...:.|.:..|.:. .|.||.  .:.||            .:|.|::..|||.|.|.|
 Frog   172 APMVRWLNNREDVTDIDDRRF--AMLPN------------NNLQIKNISKRDEGIYRC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 26/94 (28%)
Ig 127..217 CDD:299845 25/93 (27%)
IG_like 227..320 CDD:214653 22/81 (27%)
IGc2 234..311 CDD:197706 20/74 (27%)
ncam2XP_012811963.1 Ig 50..141 CDD:386229 26/95 (27%)
IG_like 150..234 CDD:214653 22/83 (27%)
Ig 237..330 CDD:386229
Ig 329..426 CDD:386229
IG_like 442..520 CDD:214653
FN3 525..617 CDD:238020
fn3 623..706 CDD:365830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.