| Sequence 1: | NP_001262320.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031755650.1 | Gene: | negr1 / 100127726 | XenbaseID: | XB-GENE-987949 | Length: | 388 | Species: | Xenopus tropicalis |
| Alignment Length: | 316 | Identity: | 73/316 - (23%) |
|---|---|---|---|
| Similarity: | 108/316 - (34%) | Gaps: | 116/316 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 123 ATSNVTTQIGTHAYLPCRVKQLGNKSVSWIR-----LRDGHILTVDRAVFIADQRFLAIKQPDKY 182
Fly 183 WTLQIKYVQARDAGSYECQVSTE--PKVSARVQLQV-VVPRTEILGEPDRYVKAGSNVVLRCIVR 244
Fly 245 GALEP--------------------------------------------------------PTFI 253
Fly 254 ---------------------------MWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSL 291
Fly 292 IIESAKKRDTGNYTCSPSN---SPSATVTLNIINGESSASAVTSSAA-TTRAYALS 343 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr11 | NP_001262320.1 | I-set | 125..216 | CDD:254352 | 28/97 (29%) |
| Ig | 127..217 | CDD:299845 | 28/97 (29%) | ||
| IG_like | 227..320 | CDD:214653 | 29/178 (16%) | ||
| IGc2 | 234..311 | CDD:197706 | 25/162 (15%) | ||
| negr1 | XP_031755650.1 | Ig | 44..136 | CDD:416386 | 29/99 (29%) |
| FR1 | 44..62 | CDD:409353 | 5/16 (31%) | ||
| Ig strand A' | 47..53 | CDD:409353 | 1/5 (20%) | ||
| Ig strand B | 55..63 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 63..68 | CDD:409353 | 0/4 (0%) | ||
| FR2 | 69..75 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 69..74 | CDD:409353 | 2/5 (40%) | ||
| CDR2 | 76..87 | CDD:409353 | 1/10 (10%) | ||
| Ig strand C' | 78..82 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 84..87 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 88..122 | CDD:409353 | 14/40 (35%) | ||
| Ig strand D | 91..98 | CDD:409353 | 3/10 (30%) | ||
| Ig strand E | 101..107 | CDD:409353 | 1/8 (13%) | ||
| Ig strand F | 114..122 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 123..127 | CDD:409353 | 2/3 (67%) | ||
| Ig strand G | 127..136 | CDD:409353 | 3/9 (33%) | ||
| FR4 | 129..136 | CDD:409353 | 2/6 (33%) | ||
| Ig_3 | 140..208 | CDD:404760 | 11/68 (16%) | ||
| Ig strand A' | 146..151 | CDD:409353 | 1/5 (20%) | ||
| Ig strand B | 157..164 | CDD:409353 | 3/6 (50%) | ||
| Ig strand C | 170..175 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 177..179 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 187..193 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 200..207 | CDD:409353 | 0/6 (0%) | ||
| Ig strand G | 214..222 | CDD:409353 | 0/7 (0%) | ||
| Ig_3 | 226..302 | CDD:404760 | 16/86 (19%) | ||
| putative Ig strand A | 226..232 | CDD:409353 | 2/5 (40%) | ||
| Ig strand B | 242..246 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 255..259 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 281..285 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 295..300 | CDD:409353 | 4/4 (100%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||