DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and negr1

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:316 Identity:73/316 - (23%)
Similarity:108/316 - (34%) Gaps:116/316 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 ATSNVTTQIGTHAYLPCRVKQLGNKSVSWIR-----LRDGHILTVDRAVFIADQRFLAIKQPDKY 182
            |..|:..:.|..|.|.|.:::..:|. :|:.     ...|...:||..|.||    .:.||.   
 Frog    45 AVDNLVVRQGETAMLRCFLEEGASKG-AWLNRSSIIFAGGDKWSVDPRVSIA----TSSKQE--- 101

  Fly   183 WTLQIKYVQARDAGSYECQVSTE--PKVSARVQLQV-VVPRTEILGEPDRYVKAGSNVVLRCIVR 244
            ::|:|:.|...|.|.|.|.|.||  |: :.:|.|.| |.|:...:.. |..|..|:||.|.|:..
 Frog   102 YSLRIQKVDVSDDGPYTCSVQTEHSPR-TLQVHLTVHVSPKIYDISS-DMTVNEGTNVSLICLAT 164

  Fly   245 GALEP--------------------------------------------------------PTFI 253
            |..||                                                        ||.:
 Frog   165 GKPEPSISWRHISPSAKQFGSGQYLDIYGITRDQAGDYECSAENDVSFPDVKKVKVTVNFAPTIL 229

  Fly   254 ---------------------------MWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSL 291
                                       .||.|.::|....|..|.|           ..:|...|
 Frog   230 EITPTGVSLGRTGLIRCETAAVPAPVFEWYKGEKKLTNGQRGIRIQ-----------NYNTRSIL 283

  Fly   292 IIESAKKRDTGNYTCSPSN---SPSATVTLNIINGESSASAVTSSAA-TTRAYALS 343
            .:.:..:...|||||...|   :.:|::.||.|...|:.|.|||||. :.:.||.|
 Frog   284 TVSNVTEEHFGNYTCVAVNKLGTSNASLPLNQIIEPSTTSPVTSSAKYSVKHYARS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 28/97 (29%)
Ig strand B 135..139 CDD:409353 2/3 (67%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 29/178 (16%)
Ig strand B 237..241 CDD:409544 2/3 (67%)
Ig strand C 252..256 CDD:409544 0/30 (0%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 1/2 (50%)
negr1XP_031755650.1 Ig 44..136 CDD:472250 29/99 (29%)
Ig strand B 57..61 CDD:409353 2/3 (67%)
Ig strand C 70..73 CDD:409353 0/3 (0%)
Ig strand E 102..106 CDD:409353 1/3 (33%)
Ig strand F 116..121 CDD:409353 2/4 (50%)
Ig strand G 129..132 CDD:409353 0/2 (0%)
Ig 146..222 CDD:472250 10/76 (13%)
Ig strand B 157..161 CDD:409301 2/3 (67%)
Ig strand C 170..174 CDD:409301 0/3 (0%)
Ig strand E 187..191 CDD:409301 0/3 (0%)
Ig strand F 201..206 CDD:409301 0/4 (0%)
Ig strand G 215..218 CDD:409301 0/2 (0%)
Ig_3 226..302 CDD:464046 16/86 (19%)

Return to query results.
Submit another query.