DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARRB1 and Arr1

DIOPT Version :9

Sequence 1:XP_016873239.1 Gene:ARRB1 / 408 HGNCID:711 Length:473 Species:Homo sapiens
Sequence 2:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster


Alignment Length:356 Identity:164/356 - (46%)
Similarity:238/356 - (66%) Gaps:11/356 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    38 RVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKE-RRVYVTLTCAFRYGREDLDV 101
            :||||.|||..:|:|:.:|||||.:..|:|:||::::|.||::: |:::|.|.|.|||||||.::
  Fly     6 KVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDEM 70

Human   102 LGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPED 166
            :||.|:|:|.:.:.|..||..:|.: ||::||||:||||.:||||..::||:.|.||.||....|
  Fly    71 IGLRFQKELTLVSQQVCPPQKQDIQ-LTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASD 134

Human   167 TGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLE 231
            ..:.|||.|.||.|..::..::.|:|:::.|.||||||||.:.|.||.....:.||:|...|.||
  Fly   135 ESQPCGVQYFVKIFTGDSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELELE 199

Human   232 ASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADD--TVA 294
            .:|||::|:|||.||||:.|.||:||.|||||..|:|..|:.||...|::..:|..|..:  .:.
  Fly   200 VTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEGCPLN 264

Human   295 PSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLV 359
            |.|:..||..|.|.|..|.::.|:|::|.:|.:||.|||:||:.....|:..||||||.|||||.
  Fly   265 PGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSYAVKVKLF 329

Human   360 VSRGGLLGDLASSDVAVELPFTLMHPKPKEE 390
            :  |.|.|:|.:     ||||.||||||..:
  Fly   330 L--GALGGELCA-----ELPFILMHPKPSRK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARRB1XP_016873239.1 None
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 71/156 (46%)
Arrestin_C 192..350 CDD:214976 76/164 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.