DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment armc3 and p120ctn

DIOPT Version :9

Sequence 1:NP_001001246.1 Gene:armc3 / 407950 XenbaseID:XB-GENE-971492 Length:863 Species:Xenopus tropicalis
Sequence 2:NP_001036444.1 Gene:p120ctn / 3355143 FlyBaseID:FBgn0260799 Length:781 Species:Drosophila melanogaster


Alignment Length:726 Identity:138/726 - (19%)
Similarity:260/726 - (35%) Gaps:192/726 - (26%)


- Green bases have known domain annotations that are detailed below.


 Frog    47 DALYKFAKKGEENKLALLELGAVDPLSKLISHEDKIVRRNATMVCGIMASHYDVRKLLRKLDIIP 111
            |:..:..|...|.||....:.:::.:.:.:..:|..:..:...:|..|      |.....|..:.
  Fly   173 DSQCRTFKSSAEFKLPQFAMSSINTVPQRLEEKDDYIEGSENDICSTM------RWRDPNLSEVI 231

 Frog   112 SLIARLTPEEEVVIHEFATL-CLAYMAAEYTSKTQIHELNGLEPLIKLLSSPDPDVKKNCAECIY 175
            |.::  .|...:..:..|.| .|.||  :..:|.:...|.|:.||::|||...|::.||....:.
  Fly   232 SFLS--NPSSAIKANAAAYLQHLCYM--DDPNKQRTRSLGGIPPLVRLLSYDSPEIHKNACGALR 292

 Frog   176 LLA---QEFQSRSAVWELNAIPPLLELL-KSEYPVIQQLTLRTLGCLSSEVEARHIFIENQVLEQ 236
            .|:   |..:::..:.....|..|:.|| :|:...:::|....|..:||..:.:...|:..::..
  Fly   293 NLSYGRQNDENKRGIKNAGGIAALVHLLCRSQETEVKELVTGVLWNMSSCEDLKRSIIDEALVAV 357

 Frog   237 LLKVLETKEFHDLHVDTLLVIANCLEDVEALHILQQSGGLKRILEFAETTPLPEAQMNAAKAISK 301
            :..|::.....|         |.|..:.....:.:.:.|:.|                   .:|.
  Fly   358 VCSVIKPHSGWD---------AVCCGETCFSTVFRNASGVLR-------------------NVSS 394

 Frog   302 AAQNDENRKFFHEQEVERILVSMLDTDNDEVKAAACLAIAAMGENLESKNVFNKQGIPQIITLLT 366
            |.::........|..||                  || :..:..::|..|:.||           
  Fly   395 AGEHARGCLRNCEHLVE------------------CL-LYVVRTSIEKNNIGNK----------- 429

 Frog   367 RESAEVRESAAFVLANLTTNC--------------------PANASA-----------VAEADGV 400
                 ..|:...:|.||:..|                    |:::..           ..||:..
  Fly   430 -----TVENCVCILRNLSYRCQEVDDPNYDKHPFITPERVIPSSSKGENLGCFGTNKKKKEANNS 489

 Frog   401 DAL--INLLSD-KRDGVIMNACTVLINMAAQEPLRLILETHGLVHALIEPLHS-SNNMVLSKAAL 461
            |||  .|:.:| .:..|..|.    :|...::     |....:|...:..|.| ||...|..||.
  Fly   490 DALNEYNISADYSKSSVTYNK----LNKGYEQ-----LWQPEVVQYYLSLLQSCSNPETLEAAAG 545

 Frog   462 TVASI-AC----DADIRTDLRNAGGLPPLVKLLQCDHNEVRRSACWAVAVCASDELTAVELYKLG 521
            .:.:: ||    ..|||..:|...|||.||:||:.   ||.|..| |||       ||:.     
  Fly   546 AIQNLSACYWQPSIDIRATVRKEKGLPILVELLRM---EVDRVVC-AVA-------TALR----- 594

 Frog   522 ALDLLQELNLSRSRRNN--FSEWALNKLLDNNLPLKYSQKGYLSY-SNLIEDGFYDCGRIKPDAK 583
                    ||:..:||.  ..::|:..|: ..||     .|.:.: .|..:|..        .|.
  Fly   595 --------NLAIDQRNKELIGKYAMRDLV-QKLP-----SGNVQHDQNTSDDTI--------TAV 637

 Frog   584 LLPLEELSKQELNQNRAVI-------LIN-AKSPDLAPAAVAPPAEEKQESV----GARSSYSRN 636
            |..:.|:.|:....:|:::       |:| .|..:...:.|...|.:...::    ..|..|.:|
  Fly   638 LATINEVIKKNPEFSRSLLDSGGIDRLMNITKRKEKYTSCVLKFASQVLYTMWQHNELRDVYKKN 702

 Frog   637 ASREKAGAPAEEKPEQAVVRTPSSHGRSASKEKGSKGKVRLKKEEEKP---------KEEEEVAQ 692
            ..:|:...............:|::...:.::...|:|:.|.   |::.         ...:....
  Fly   703 GWKEQDFVSKHFTAHNTPPSSPNNVNNTLNRPMASQGRTRY---EDRTIQRGTSTLYSANDSSGA 764

 Frog   693 FLQNQSLIVSE 703
            .:.|:|.::||
  Fly   765 VMSNESAMLSE 775

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armc3NP_001001246.1 armadillo repeat 62..94 CDD:293788 2/31 (6%)
armadillo repeat 104..136 CDD:293788 6/32 (19%)
armadillo repeat 144..179 CDD:293788 11/37 (30%)
PLN03200 155..>405 CDD:215629 47/286 (16%)
armadillo repeat 184..218 CDD:293788 7/34 (21%)
HEAT repeat 276..301 CDD:293787 1/24 (4%)
HEAT repeat 317..345 CDD:293787 4/27 (15%)
armadillo repeat 352..383 CDD:293788 4/30 (13%)
Arm 387..426 CDD:366143 12/72 (17%)
armadillo repeat 391..427 CDD:293788 10/49 (20%)
HEAT repeat 435..466 CDD:293787 9/31 (29%)
ARM 469..504 CDD:214547 15/34 (44%)
armadillo repeat 473..503 CDD:293788 13/29 (45%)
EDR1 <712..849 CDD:373038
p120ctnNP_001036444.1 ARM 227..341 CDD:237987 28/117 (24%)
armadillo repeat 227..252 CDD:293788 5/26 (19%)
armadillo repeat 260..296 CDD:293788 12/35 (34%)
armadillo repeat 304..339 CDD:293788 7/34 (21%)
ARM 307..442 CDD:237987 30/197 (15%)
armadillo repeat 347..392 CDD:293788 7/72 (10%)
armadillo repeat 515..556 CDD:293788 11/45 (24%)
ARM 516..643 CDD:237987 44/169 (26%)
armadillo repeat 562..596 CDD:293788 18/57 (32%)
armadillo repeat 601..641 CDD:293788 11/53 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.