DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and ZNF468

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_016882932.1 Gene:ZNF468 / 90333 HGNCID:33105 Length:541 Species:Homo sapiens


Alignment Length:339 Identity:88/339 - (25%)
Similarity:149/339 - (43%) Gaps:65/339 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ICKSCKVELNMAYQFREKALRKQM---EIEEYCRE--------------LGLLDESDVMMIKEED 106
            ||  |:.:.:::.::...:|...:   :.|.:.||              ..||.:..::.::|: 
Human   199 IC--CRPKTHISNKYGNNSLHSSLLTQKWEVHMREKSFECIQSFKSFNCSSLLKKHQIIHLEEK- 260

  Fly   107 GSQQQCD-------EEMYIL--EETTTGEEEHQ-----EEKGHEEYL----EVDTSDQ-QECIGD 152
              |.:||       ::.|:.  ....|||:.::     :..||...|    .:.|.:: .||   
Human   261 --QCKCDVCGKVFNQKRYLACHRRCHTGEKPYKCNECGKTFGHNSSLFIHKALHTGEKPYEC--- 320

  Fly   153 TIEYLEDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEAAKASLKARRGRVRRGLNSLTTSDG 217
              |..:..::.:.:.::.:.:...||.|:    .::..:..|..|..|:...:..|         
Human   321 --EECDKVFSRKSHLERHKRIHTGEKPYK----CKVCDEAFAYNSYLAKHTILHTG--------- 370

  Fly   218 TEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLRKHMYSHTGSKPYKCS 282
             || .|.|:.||..:.:...:..|.|.|.|...|.||.||..|..:..|.:|...|:|.|||||.
Human   371 -EK-PYTCNECGKVFNRLSTLARHHRLHTGEKPYKCEECDKVFSRKSHLERHRRIHSGEKPYKCE 433

  Fly   283 FCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKDF--- 344
            .|.:.|..:|.|:.|..:|.|.|||.||||||||.....|.:|:.:|:..|.|:|:.|.|.|   
Human   434 ECCKVFSRKSNLERHRRIHTGEKPYKCKVCDKAFQRDSHLAQHQRVHTGEKPYKCNECGKTFGQT 498

  Fly   345 -RLLHHMRQHEETK 357
             .|:.|.|.|...|
Human   499 SSLIIHRRLHTGEK 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 5/30 (17%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
COG5048 <250..369 CDD:227381 47/112 (42%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 266..288 CDD:290200 10/21 (48%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 294..318 CDD:290200 15/23 (65%)
C2H2 Zn finger 309..329 CDD:275368 10/19 (53%)
C2H2 Zn finger 337..353 CDD:275368 7/19 (37%)
ZNF468XP_016882932.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.