DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and TT1

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_174737.2 Gene:TT1 / 840386 AraportID:AT1G34790 Length:303 Species:Arabidopsis thaliana


Alignment Length:295 Identity:60/295 - (20%)
Similarity:101/295 - (34%) Gaps:85/295 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 MYILEETTTGEEEHQEEKGHEEYLEV-DTSDQQECIGDT-------IEYLEDNYTIEMNSDQTEI 172
            :|.:..:::.|    :.:.|.:.|:: ...:|..||.:|       |:.:..|..:::|.:  .:
plant     6 LYEISSSSSSE----KPRHHFQSLDLFPNLNQNSCINNTLIEPLPLIDRINLNSNLDLNPN--PL 64

  Fly   173 VLESEKQYEETPSQQ---------LALQEAAKASLKARRGRVRRGLNSLTTSDG----TEKGG-- 222
            ..|..:|.||...::         :.|....|.|..|::.:.|.|....|...|    .|..|  
plant    65 YAEEGEQEEEEEEEEDREVDVDLHIGLPGFGKPSNDAKQLKKRNGKEIATYDAGKGIENELSGKA 129

  Fly   223 ---------------YICDVCGNFYEKRGRMMEHRRRHD-------------------GICQYAC 253
                           :.|.||...:.:...:..|...|.                   ||..|.|
plant   130 YWIPAPEQILIGFTHFSCHVCFKTFNRYNNLQMHMWGHGSQYRKGPESLKGTQPRAMLGIPCYCC 194

  Fly   254 ELCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAY 318
            .         |..|.|: .|..|||.|      .|   ..|::|.....|.||:.|::|.|..|.
plant   195 V---------EGCRNHI-DHPRSKPLK------DF---RTLQTHYKRKHGHKPFSCRLCGKLLAV 240

  Fly   319 AHSLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQH 353
            ......||  .:..|.:.| .|..||:....::.|
plant   241 KGDWRTHE--KNCGKRWVC-VCGSDFKHKRSLKDH 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
COG5048 <250..369 CDD:227381 28/104 (27%)
C2H2 Zn finger 253..273 CDD:275368 4/19 (21%)
zf-H2C2_2 266..288 CDD:290200 7/21 (33%)
C2H2 Zn finger 281..301 CDD:275368 3/19 (16%)
zf-H2C2_2 294..318 CDD:290200 8/23 (35%)
C2H2 Zn finger 309..329 CDD:275368 6/19 (32%)
C2H2 Zn finger 337..353 CDD:275368 4/15 (27%)
TT1NP_174737.2 C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
C2H2 Zn finger 257..274 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.