Sequence 1: | NP_001189188.1 | Gene: | Zif / 40795 | FlyBaseID: | FBgn0037446 | Length: | 388 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_172306.1 | Gene: | WIP3 / 837349 | AraportID: | AT1G08290 | Length: | 337 | Species: | Arabidopsis thaliana |
Alignment Length: | 252 | Identity: | 54/252 - (21%) |
---|---|---|---|
Similarity: | 92/252 - (36%) | Gaps: | 74/252 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 144 SDQQECIGDTIEYLEDNYTIEM---------NSDQTEIVLESEKQYEETPSQQLALQEAAKASLK 199
Fly 200 ARRGRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVRE 264
Fly 265 QLRKHMYSHTGSKPYK------------------CSFCS---------------RQFFYESVLKS 296
Fly 297 HENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQH 353 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zif | NP_001189188.1 | zf-AD | 9..87 | CDD:285071 | |
C2H2 Zn finger | 225..245 | CDD:275368 | 5/19 (26%) | ||
COG5048 | <250..369 | CDD:227381 | 33/137 (24%) | ||
C2H2 Zn finger | 253..273 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 266..288 | CDD:290200 | 8/54 (15%) | ||
C2H2 Zn finger | 281..301 | CDD:275368 | 5/34 (15%) | ||
zf-H2C2_2 | 294..318 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 309..329 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 337..353 | CDD:275368 | 4/15 (27%) | ||
WIP3 | NP_172306.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 62 | 1.000 | Inparanoid score | I2531 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |