DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and CG1792

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:375 Identity:92/375 - (24%)
Similarity:153/375 - (40%) Gaps:67/375 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ESPNEMLIQ---------LLGVSYSNLNDREHIPDGICKSCKVELNMAYQFREKALRKQMEIEEY 87
            |.||.:::.         |||      .....:|..||..|:::|..|..|||:.:|.|..::| 
  Fly    23 EEPNSVMLHQIEVLTGLFLLG------GPGNELPPFICSPCELDLQTAIAFRERVIRTQKTLQE- 80

  Fly    88 CRELGLLDESDVMMIKEEDGSQQQCDEEMYILEETTTGEEEHQEEKGHEEYLEVDTSDQQECIGD 152
            ...||..:                      ::|....|.|  :|.:..||..|:          :
  Fly    81 SPNLGNAE----------------------LIESFAVGVE--KEIQYAEEVTEI----------E 111

  Fly   153 TIEYLEDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEAAK------ASLK-ARRGRVRRGLN 210
            .|:.|.:.:.:|...:..||..::|:...:.|:|:..|:.:.|      .|:| |...:..|...
  Fly   112 VIDLLPEEHLLEETEEPYEICEQNEQPQVKVPAQEKKLRRSTKTTPTVFTSVKFADNSQATRTQW 176

  Fly   211 SLTTSDGT-------EKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLRK 268
            |..|.|..       .|...||:.||..:........|..||.|:..:||:.|..:|.....||:
  Fly   177 SRLTEDEVVALKRERRKRDCICEQCGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRR 241

  Fly   269 HMYSHTGSKPYKCSFCSRQFFYESVLKSHENV-HRGIKPYVCKVCDKAFAYAHSLTKHELIHSDI 332
            |...|.|:..::|.:|...:...|....||.: |..:||:.||.|:|:||.:..|..|.|.|:.:
  Fly   242 HQELHAGNALFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGV 306

  Fly   333 KLYRCDYCNKDFRLLHHMRQHEETK--LHQNAVMLAESMKVEMVAEQGGG 380
            :.:.||.|...|....|:..|..:|  .|.::...|....||:..:...|
  Fly   307 RAFHCDSCQVSFVRRSHLTSHYRSKGHAHTSSAQAALDNPVELDVKASNG 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 17/63 (27%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
COG5048 <250..369 CDD:227381 36/121 (30%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 266..288 CDD:290200 7/21 (33%)
C2H2 Zn finger 281..301 CDD:275368 5/20 (25%)
zf-H2C2_2 294..318 CDD:290200 10/24 (42%)
C2H2 Zn finger 309..329 CDD:275368 9/19 (47%)
C2H2 Zn finger 337..353 CDD:275368 5/15 (33%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 17/62 (27%)
C2H2 Zn finger 198..218 CDD:275368 4/19 (21%)
C2H2 Zn finger 226..243 CDD:275368 5/16 (31%)
C2H2 Zn finger 254..275 CDD:275368 5/20 (25%)
zf-C2H2 281..303 CDD:278523 9/21 (43%)
C2H2 Zn finger 283..303 CDD:275368 9/19 (47%)
zf-H2C2_2 296..320 CDD:290200 8/23 (35%)
C2H2 Zn finger 311..329 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I19525
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.