DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and CG4936

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster


Alignment Length:483 Identity:127/483 - (26%)
Similarity:188/483 - (38%) Gaps:154/483 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRVCLAQ-SERLQRLDEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSCKVELNMAYQF 73
            |||||.| .|.:..:  ..::.|:....|:.:..||.   :...:|.||.||:.|...|.||::|
  Fly    23 CRVCLQQPKEPMASI--FNDDSEKDLTHMIRECGGVP---IKQFDHYPDKICEKCFKVLKMAFKF 82

  Fly    74 REKALRK---------QMEIEE------------------------------------------Y 87
            ||...|.         .:|:|:                                          |
  Fly    83 RETCQRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHY 147

  Fly    88 CR----------------ELGLLDESD---VMMIKEEDGSQQQCDEEMYILEETTTGEEEHQEEK 133
            ..                |.|:|.|.:   ::.:|.|...:....||:|.:.||..|:....:..
  Fly   148 AEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLIPDQGY 212

  Fly   134 GHEEYLEVDTSDQQ-ECIGDTIEYLE----DNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEA 193
            .||      .:||. ..:...||||:    |..|...:.|..|:.|.|.:: |..||:.:.....
  Fly   213 DHE------MADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEE-EFVPSKSVRASIH 270

  Fly   194 AKASLKAR------------------------RG---RVRRGLNSLTTSDGTE------------ 219
            |:.:.|.|                        ||   :|||| ||  .|.|::            
  Fly   271 ARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRG-NS--DSAGSKMSIKSEKDISIG 332

  Fly   220 ------------KGG------------YICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKF 260
                        |||            ||||||||.|..:.|:.||.:.|.|:..:.||:|...|
  Fly   333 EVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCF 397

  Fly   261 QVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKH 325
            ...:||.:||.:|||::|||||:|...|...|....|..:|...:||.|.||.|.|.|.::|..|
  Fly   398 AQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFH 462

  Fly   326 ELIHSDIKLYRCDYCNKDFRLLHHMRQH 353
            ::||:..|.:.||.|.|.|...:.:|.|
  Fly   463 KMIHTGEKPHVCDVCGKGFPQAYKLRNH 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 26/128 (20%)
C2H2 Zn finger 225..245 CDD:275368 10/19 (53%)
COG5048 <250..369 CDD:227381 41/104 (39%)
C2H2 Zn finger 253..273 CDD:275368 8/19 (42%)
zf-H2C2_2 266..288 CDD:290200 12/21 (57%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 294..318 CDD:290200 9/23 (39%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
C2H2 Zn finger 337..353 CDD:275368 6/15 (40%)
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 24/76 (32%)
C2H2 Zn finger 362..382 CDD:275368 10/19 (53%)
zf-H2C2_2 375..399 CDD:290200 8/23 (35%)
COG5048 386..>447 CDD:227381 23/60 (38%)
C2H2 Zn finger 390..410 CDD:275368 8/19 (42%)
zf-H2C2_2 403..426 CDD:290200 12/22 (55%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-H2C2_2 432..455 CDD:290200 9/22 (41%)
C2H2 Zn finger 446..466 CDD:275368 8/19 (42%)
zf-H2C2_2 459..481 CDD:290200 9/21 (43%)
C2H2 Zn finger 474..494 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457878
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C1GA
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.