DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and Odj

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster


Alignment Length:411 Identity:100/411 - (24%)
Similarity:163/411 - (39%) Gaps:95/411 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRVCLAQSERL----------QRLDEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSCK 64
            ||:|   .||:          :|...||...|:      |..|.:...|:     :|..||..|.
  Fly     5 CRIC---GERIFTPHPKNIFEKRNHRIRMAIEQ------ITGLEIVLENM-----LPQHICACCL 55

  Fly    65 VELNMAYQFREKALRKQMEI-EEYCRELGLLDE---------SDVMMIKEEDGSQQQCDEEMYIL 119
            ::|..|..||::.|.....: :....:.|:..:         ||.::.:|             :|
  Fly    56 LDLTQAVAFRQRCLETHANLHQRISSKAGVASKGSPEVSPVLSDPLLKRE-------------VL 107

  Fly   120 EETTTGEEEHQEEKGHEEYLEVDTSDQQECIGDTIEYLEDNYTIEMNSDQTEIVLESE----KQY 180
            ::|...|::       :|.|:    |.::.:.|..::|||...|.......:|.:|.:    :|.
  Fly   108 DDTVDTEDD-------KELLD----DDKDLMDDDKDFLEDEKPILRYPPAKKIRIEDQNFPNRQS 161

  Fly   181 EETPSQQLALQEAAKASL-------KARRGRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGRM 238
            .....::|.:....||..       ..|:.|.||....:..|...    |:||.||..:.....|
  Fly   162 PRVRVKRLRVPVVEKADSPPPPPREHVRKPRKRRPKPKVDRSIKR----YVCDQCGWSFNDHSNM 222

  Fly   239 MEHRRRHDGICQYACELCDAKFQVREQLRKHM-YSHTGSKPYKCSFCSRQFF-------YESVLK 295
            .:|:.||... :::|:.|..||.....||.|: ..|.|.|||.|.||...|.       :|..:.
  Fly   223 KDHKLRHFEE-KFSCDECGRKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMH 286

  Fly   296 SHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHS----DIKLYRCDYCNKDFRLLHHMRQHEET 356
            ::|.||      .||:|.|.|.......|||..|.    |:.:  |..|||:|:....:.:|..|
  Fly   287 ANELVH------PCKICGKRFNSEKGRLKHEEGHKSDQPDVHI--CLTCNKEFKEAQFLHRHYST 343

  Fly   357 KLHQNAV-MLAESMKVEMVAE 376
            |.|:..| :|....|.|..:|
  Fly   344 KYHRKRVNLLVNGPKEEFQSE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 21/87 (24%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
COG5048 <250..369 CDD:227381 41/131 (31%)
C2H2 Zn finger 253..273 CDD:275368 7/20 (35%)
zf-H2C2_2 266..288 CDD:290200 11/22 (50%)
C2H2 Zn finger 281..301 CDD:275368 6/26 (23%)
zf-H2C2_2 294..318 CDD:290200 8/23 (35%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
C2H2 Zn finger 337..353 CDD:275368 5/15 (33%)
OdjNP_650661.1 zf-AD 5..77 CDD:214871 21/85 (25%)
COG5048 <202..343 CDD:227381 46/153 (30%)
C2H2 Zn finger 209..229 CDD:275368 6/19 (32%)
C2H2 Zn finger 236..256 CDD:275368 7/19 (37%)
zf-H2C2_2 249..274 CDD:290200 12/24 (50%)
C2H2 Zn finger 265..283 CDD:275368 4/17 (24%)
C2H2 Zn finger 298..314 CDD:275368 5/15 (33%)
zf-C2H2_jaz 322..347 CDD:288983 8/26 (31%)
C2H2 Zn finger 324..343 CDD:275368 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26139
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.