DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and CG17801

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster


Alignment Length:405 Identity:96/405 - (23%)
Similarity:157/405 - (38%) Gaps:76/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PQTCRVCLAQSERLQRLDEIREEGEESPN-----EMLIQLLGVSYSNLNDREHIPDGICKSCKVE 66
            |..|.:|.:....|            :|.     |:|.::..::...|...|..|..||.||..:
  Fly     7 PSQCHLCASCFCHL------------NPTIIFCLEVLAKIKDLTGIWLEQNERQPRHICPSCLND 59

  Fly    67 LNMAYQFREKALRKQMEIEEYCRELGLLD--ESDVMMIKEEDGSQQQCDEEMYILEETTTGEEEH 129
            ||.:.:.:::..|...| ....||.||.:  ||.|..|:.|..|.....||.|      ..|...
  Fly    60 LNTSIKLKKRIQRVHNE-ATLRRESGLDEDLESTVSDIEPEGDSSDLESEESY------DSENYP 117

  Fly   130 QEEKGHEEYLEVDTSDQQECIGDTIEYLEDNYTIEMN--SDQTEIVLESEKQYEETPS---QQLA 189
            .::|..|..::::.:.            ||......|  ..:|.::.:.:....||||   :.|.
  Fly   118 FDKKAEESDIDLNLAH------------EDRRNEPHNPYDSETPLIFKHKNPLIETPSFANENLP 170

  Fly   190 LQEAAKASLKARRGRVRRGLNSLTT--------------------------SDGTEKGGYICDVC 228
            .:..||:..|....::...|..|||                          ....:....:|..|
  Fly   171 NKVDAKSPKKGNFIQIGTDLRLLTTYPSIKVVKPLALAPEDVAAENVPPAKRTARKMQSLVCPKC 235

  Fly   229 GNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLRKH-MYSHTGSKPYKCSFCSRQFFYES 292
            |..::....:..|..||.|...:.|..||.:|..:...|.| ...|.|.:|::|:|||..||..:
  Fly   236 GRVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATFFTST 300

  Fly   293 VLKSHENVH--RGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQHEE 355
            ...|||.:.  |.:: |.|..|.|.|.....|.||:.:||.:|.:.|..|..:|.....:|.|.:
  Fly   301 AKSSHERIRHIRDLR-YQCDQCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRSHFD 364

  Fly   356 TKLHQ---NAVMLAE 367
            :..||   :|::.:|
  Fly   365 SVAHQKRASAILESE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 17/82 (21%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
COG5048 <250..369 CDD:227381 39/124 (31%)
C2H2 Zn finger 253..273 CDD:275368 6/20 (30%)
zf-H2C2_2 266..288 CDD:290200 9/22 (41%)
C2H2 Zn finger 281..301 CDD:275368 9/19 (47%)
zf-H2C2_2 294..318 CDD:290200 9/25 (36%)
C2H2 Zn finger 309..329 CDD:275368 7/19 (37%)
C2H2 Zn finger 337..353 CDD:275368 4/15 (27%)
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 16/76 (21%)
zf-C2H2 231..252 CDD:278523 4/20 (20%)
C2H2 Zn finger 232..252 CDD:275368 4/19 (21%)
zf-H2C2_2 244..269 CDD:290200 8/24 (33%)
C2H2 Zn finger 260..281 CDD:275368 6/20 (30%)
C2H2 Zn finger 289..308 CDD:275368 9/18 (50%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
C2H2 Zn finger 346..362 CDD:275368 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.