DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and CG17803

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster


Alignment Length:501 Identity:102/501 - (20%)
Similarity:172/501 - (34%) Gaps:192/501 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRVCLAQSERLQRLDEIREEGEESPNEMLIQLL-------------GVSYSNLNDREHIPDGICK 61
            ||.|.       |:....|:.::..:.:.|.||             ||        :.:|..||.
  Fly    86 CRTCF-------RIISRHEDAQDLYDRVNIALLHHIKVITGVWIQQGV--------KELPHHICS 135

  Fly    62 SCKVELNMAYQFREKALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQQQCDEEMYILEETTTGE 126
            :|:..:|.:.:||.|..:...::.:...:..:                |.|||||....|....|
  Fly   136 TCQETVNKSMEFRAKCQQVDKKLRQTTEKYNI----------------QICDEEMESELENVLYE 184

  Fly   127 EEHQEEKG--------------HEEYLEVD-------------TSDQQECIGDTIEYLEDNYTIE 164
            |..|:.||              .|..|:.|             :.|:.:...||    |.::.:|
  Fly   185 ESAQQAKGVVGLEDFSSELLPDSEGVLDEDDFPLDAEPTQFSLSEDELDLDRDT----EKDFALE 245

  Fly   165 MNSDQTEIVL--------------ESEKQYEETPSQQLALQEAA-KASL--------------KA 200
            .|....||:.              ...|.|:....:..:|:|.| |.||              |.
  Fly   246 QNKSCNEIISIRKCKTKEEIGKVDHGAKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEKN 310

  Fly   201 RRGRVR---RGLNSLTTSDGTEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKF-- 260
            ||.|.|   :.||            |:||.||:.:.:|.::..|..||:....:.|..|..||  
  Fly   311 RRRRERIQAKPLN------------YVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYD 363

  Fly   261 ---------------------------------------------QVREQLRK------------ 268
                                                         ::|.:::.            
  Fly   364 LYTRNIHVRALHKGEHPFPCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQ 428

  Fly   269 -------------HMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAH 320
                         ||..|.||:|::|..|..:|...|.:|.|:.:|... |..|.:|.|.|....
  Fly   429 CTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQALHDKF-PIRCDICLKGFLLRS 492

  Fly   321 SLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQHEETKLHQNAVMLA 366
            .||||:.:|:.:..:||:.|:..:|..:::.:|:.|.||::.:..|
  Fly   493 QLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTDLHRDNMQKA 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 18/89 (20%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
COG5048 <250..369 CDD:227381 37/189 (20%)
C2H2 Zn finger 253..273 CDD:275368 7/91 (8%)
zf-H2C2_2 266..288 CDD:290200 8/46 (17%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 294..318 CDD:290200 8/23 (35%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
C2H2 Zn finger 337..353 CDD:275368 3/15 (20%)
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 18/88 (20%)
COG5048 <323..528 CDD:227381 43/217 (20%)
zf-C2H2 324..346 CDD:278523 7/21 (33%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..375 CDD:275368 4/20 (20%)
C2H2 Zn finger 383..401 CDD:275368 0/17 (0%)
C2H2 Zn finger 426..446 CDD:275368 2/19 (11%)
C2H2 Zn finger 454..474 CDD:275368 6/19 (32%)
C2H2 Zn finger 481..501 CDD:275368 8/19 (42%)
C2H2 Zn finger 509..528 CDD:275368 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.