DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and CG6654

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster


Alignment Length:149 Identity:48/149 - (32%)
Similarity:74/149 - (49%) Gaps:7/149 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 TEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLRKHMYSHTGSKPYKCS 282
            :|...:.|::|.:.:..:..:..|.|.|.|...:.||:|.|:|.....|.||...|||.:||.|.
  Fly   463 SETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACD 527

  Fly   283 FCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKDFRLL 347
            .|..:|...:|||:|...|.|.:||||..|.|.|........|:..|...::|.|..||::|:.:
  Fly   528 LCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQGERIYICPVCNEEFKSM 592

  Fly   348 HHMR-------QHEETKLH 359
            ..||       ||::..:|
  Fly   593 PEMRSHLAGHEQHDKRLVH 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
COG5048 <250..369 CDD:227381 41/117 (35%)
C2H2 Zn finger 253..273 CDD:275368 8/19 (42%)
zf-H2C2_2 266..288 CDD:290200 10/21 (48%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
zf-H2C2_2 294..318 CDD:290200 12/23 (52%)
C2H2 Zn finger 309..329 CDD:275368 5/19 (26%)
C2H2 Zn finger 337..353 CDD:275368 6/22 (27%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368
COG5048 <357..570 CDD:227381 36/106 (34%)
C2H2 Zn finger 360..380 CDD:275368
C2H2 Zn finger 385..406 CDD:275370
C2H2 Zn finger 414..434 CDD:275368
zf-H2C2_2 427..451 CDD:290200
C2H2 Zn finger 442..490 CDD:275368 5/26 (19%)
C2H2 Zn finger 470..487 CDD:275368 2/16 (13%)
zf-H2C2_2 482..507 CDD:290200 9/24 (38%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 510..534 CDD:290200 10/23 (43%)
C2H2 Zn finger 526..546 CDD:275368 7/19 (37%)
zf-H2C2_2 539..563 CDD:290200 12/23 (52%)
C2H2 Zn finger 554..574 CDD:275368 5/19 (26%)
C2H2 Zn finger 582..602 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.