DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and CG17328

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster


Alignment Length:351 Identity:84/351 - (23%)
Similarity:141/351 - (40%) Gaps:78/351 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRVCLAQSERLQRLDEI-REEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSCKVELNMAYQF 73
            |||||   |.|..:..| ..:....|:.||:|...:   .:...:.:|..||.:|...|.:|:.|
  Fly     9 CRVCL---EELHPVTSIYSTDFAMMPSVMLMQCAKI---RVFKTDGLPSVICNNCIYRLGVAFHF 67

  Fly    74 REKALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQQQCDEEMYILEETTTGEEEHQEEKGHEEY 138
            :::.....:.:.:|   ||:|:.      ..:|.:......|..:|.:..:.|||..:.|     
  Fly    68 KQECENSDLRLRQY---LGILES------WRQDAATNTDFVEKPLLPQRDSDEEEPVDAK----- 118

  Fly   139 LEVDTSDQQECIGDTIEYLEDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEAAKASLKARRG 203
                                              |.:...:|:..|.::                
  Fly   119 ----------------------------------VSKRRSRYQRKPPEE---------------- 133

  Fly   204 RVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLRK 268
            ..:||...:      .|..:.|..|...::...::.:|.|.|.|...|.|..|..:|..:..|:.
  Fly   134 HKKRGPKPV------PKMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKV 192

  Fly   269 HMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIK 333
            |..:|||.||::|..||:||......::|:.:|.|::..||.:|.|.|..|..|:||.:.|:.||
  Fly   193 HERTHTGDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIK 257

  Fly   334 LYRCDYCNKDFRLLHHMRQHEETKLH 359
            .:.||.|.|.|.....||.| :.|||
  Fly   258 NHHCDVCGKAFSRRRDMRTH-KLKLH 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 19/77 (25%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
COG5048 <250..369 CDD:227381 42/110 (38%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
zf-H2C2_2 266..288 CDD:290200 10/21 (48%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 294..318 CDD:290200 8/23 (35%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
C2H2 Zn finger 337..353 CDD:275368 7/15 (47%)
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 19/76 (25%)
COG5048 146..>211 CDD:227381 20/64 (31%)
C2H2 Zn finger 149..169 CDD:275368 4/19 (21%)
C2H2 Zn finger 177..197 CDD:275368 5/19 (26%)
zf-H2C2_2 189..213 CDD:404364 11/23 (48%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
C2H2 Zn finger 233..253 CDD:275368 8/19 (42%)
zf-H2C2_2 245..270 CDD:404364 11/24 (46%)
C2H2 Zn finger 261..282 CDD:275368 9/21 (43%)
C2H2 Zn finger 318..338 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.