DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and CG2202

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster


Alignment Length:444 Identity:106/444 - (23%)
Similarity:165/444 - (37%) Gaps:120/444 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VELTPQTC----RVCLAQSERLQRLDEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSC 63
            :.:.|:.|    .|.||...:|::....||:.|....        .|.......|||..|..:..
  Fly   316 LHIKPEPCLEAEEVDLAMQLKLEKKRRRREKAEAQAE--------TSIDRTVKNEHIAIGDSQFS 372

  Fly    64 KVELNMAYQFREKALRKQMEIEEYCR-----ELGLLDE----------SDVMMIKEEDGSQQQCD 113
            ..|.|......::|   .|.:|::.:     ||.|.||          ||:....::|..:...|
  Fly   373 IKEENQLVGSDDEA---PMGVEDFMKLHVSGELPLSDEERFDGFADDDSDLDDDDDDDDEEDAGD 434

  Fly   114 E---EMYILEETTTGEE-------------EHQEEKGHEEYLEV-DTSDQQEC--IGDTIEYLE- 158
            :   |..:.:|...||:             .:::|...:...|| ..:..:.|  :...:.:|| 
  Fly   435 DDDGEFRLKQEPLDGEKPLKKAKSGRRRRRRNKDEPNPDNRCEVCQRTFSRHCHLLRHKLSHLEK 499

  Fly   159 ---------------DNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEAAKASLKARRGRVRRG 208
                           |:....:.|      |.|.|::      :.:|.|||.:.|.|    :.|.
  Fly   500 KPHNCPHCPKAFARSDHLKAHVQS------LHSNKEH------KCSLCEAAFSRLDA----LERH 548

  Fly   209 LNSLTTSDGTEKGG-----------------------------------YICDVCGNFYEKRGRM 238
            ..|....:|.|.|.                                   |.|..|...:.:|.::
  Fly   549 KVSKHNGEGLEPGSELKLQLAEHTCEYCSKRFSSKTYLRKHTLLHTDFLYACKTCDETFRERAQL 613

  Fly   239 MEHRRRHDGICQYACELCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRG 303
            .||.:.|.|...:.|.:|...|...:.||.||..|.|.|||||.||.:.|...:.||.||..|.|
  Fly   614 REHEKTHTGQRNFLCCICGDSFARNDYLRVHMRRHNGEKPYKCRFCVKAFPRATDLKVHERYHTG 678

  Fly   304 IKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKDFR----LLHHMRQH 353
            .||.:|..|.|:|..|::||.|...|:..:.|:||.|.|.|.    |..|:|:|
  Fly   679 TKPNLCNTCGKSFHRAYNLTIHMRTHTGERPYKCDQCPKSFTQSNDLKAHIRRH 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 18/81 (22%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
COG5048 <250..369 CDD:227381 44/108 (41%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 266..288 CDD:290200 13/21 (62%)
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)
zf-H2C2_2 294..318 CDD:290200 12/23 (52%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
C2H2 Zn finger 337..353 CDD:275368 8/19 (42%)
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 75/302 (25%)
C2H2 Zn finger 476..496 CDD:275368 3/19 (16%)
zf-H2C2_2 488..513 CDD:290200 2/24 (8%)
C2H2 Zn finger 504..525 CDD:275368 2/26 (8%)
C2H2 Zn finger 532..548 CDD:275368 6/19 (32%)
C2H2 Zn finger 573..593 CDD:275368 0/19 (0%)
C2H2 Zn finger 600..620 CDD:275368 5/19 (26%)
zf-H2C2_2 613..637 CDD:290200 7/23 (30%)
C2H2 Zn finger 628..648 CDD:275368 7/19 (37%)
zf-H2C2_2 640..663 CDD:290200 13/22 (59%)
C2H2 Zn finger 656..676 CDD:275368 8/19 (42%)
C2H2 Zn finger 684..704 CDD:275368 8/19 (42%)
zf-C2H2 684..704 CDD:278523 8/19 (42%)
zf-H2C2_2 696..721 CDD:290200 10/24 (42%)
C2H2 Zn finger 712..732 CDD:275368 8/19 (42%)
C2H2 Zn finger 739..755 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.