DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Zif and ZNF707

DIOPT Version :9

Sequence 1:	NP_001189188.1	Gene:	Zif / 40795	FlyBaseID:	FBgn0037446	Length:	388	Species:	Drosophila melanogaster
Sequence 2:	NP_001094068.1	Gene:	ZNF707 / 286075	HGNCID:	27815	Length:	371	Species:	Homo sapiens

Alignment Length:	142	Identity:	45/142 - (31%)
Similarity:	71/142 - (50%)	Gaps:	0/142 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   218 TEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLRKHMYSHTGSKPYKCS 282
            |.:..:.|:.||..:..:.|:.:||:.|.....|:|..|...|:.:..|.:|...|||.:|:.|:
Human   227 TREKPFCCEACGQAFSLKDRLAQHRKVHTEHRPYSCGDCGKAFKQKSNLLRHQLVHTGERPFYCA 291

  Fly   283 FCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKDFRLL 347
            .|.:.|..:..|..|:.||.|.|||.|..|.|:|.:....:.|..:|...:.|.|.:|.|.||.|
Human   292 DCGKAFRTKENLSHHQRVHSGEKPYTCAECGKSFRWPKGFSIHRRLHLTKRFYECGHCGKGFRHL 356

  Fly   348 HHMRQHEETKLH 359
            ....:|:.|..|
Human   357 GFFTRHQRTHRH 368

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Zif	NP_001189188.1	zf-AD	9..87	CDD:285071
		C2H2 Zn finger	225..245	CDD:275368	6/19 (32%)
		COG5048	<250..369	CDD:227381	37/110 (34%)
		C2H2 Zn finger	253..273	CDD:275368	5/19 (26%)
		zf-H2C2_2	266..288	CDD:290200	8/21 (38%)
		C2H2 Zn finger	281..301	CDD:275368	5/19 (26%)
		zf-H2C2_2	294..318	CDD:290200	12/23 (52%)
		C2H2 Zn finger	309..329	CDD:275368	5/19 (26%)
		C2H2 Zn finger	337..353	CDD:275368	6/15 (40%)
ZNF707	NP_001094068.1	KRAB	8..68	CDD:214630
		KRAB	8..47	CDD:279668
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	71..143
		C2H2 Zn finger	178..198	CDD:275368
		COG5048	<187..366	CDD:227381	43/138 (31%)
		C2H2 Zn finger	206..226	CDD:275368
		zf-H2C2_2	218..242	CDD:290200	4/14 (29%)
		C2H2 Zn finger	234..254	CDD:275368	6/19 (32%)
		zf-C2H2	260..282	CDD:278523	6/21 (29%)
		C2H2 Zn finger	262..282	CDD:275368	5/19 (26%)
		zf-H2C2_2	274..299	CDD:290200	9/24 (38%)
		C2H2 Zn finger	290..310	CDD:275368	5/19 (26%)
		zf-H2C2_2	302..325	CDD:290200	11/22 (50%)
		C2H2 Zn finger	318..338	CDD:275368	5/19 (26%)
		C2H2 Zn finger	346..366	CDD:275368	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910