DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and ace2

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_594109.1 Gene:ace2 / 2541661 PomBaseID:SPAC6G10.12c Length:533 Species:Schizosaccharomyces pombe


Alignment Length:318 Identity:60/318 - (18%)
Similarity:108/318 - (33%) Gaps:98/318 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SPNEMLIQL-----------LGVSYSNLNDREHIPDGICKSCKVELNMAYQFREKALRKQMEIEE 86
            ||...|::|           |..|:|:|:        :|:         :...:||..|.....|
pombe   276 SPFAQLVKLEPTSPQKPSFALDSSFSHLD--------VCR---------HTDNQKAFAKLSSPAE 323

  Fly    87 YCRELGLLDESDVMMIKEEDGSQQQCDEEMYI----LEETTTGEEEHQEEKGHEEYLEVDTSDQQ 147
            |              :.|.:.....||..:.|    :..|.|  ::......:|..  :.|...:
pombe   324 Y--------------VSEFEKFSSVCDHGLDISNANINNTLT--QQFALSAPYESC--IVTKKPE 370

  Fly   148 ECIGDTIEYLEDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEAAKASLKARRGRVRRGLNSL 212
            .||  |::. |:....::.|....|. ....:::..|..:::.....|...::.|          
pombe   371 PCI--TVKE-EEQLAPKIESADLSIT-PQVTEHDSKPPVRISYDHRCKTRKQSTR---------- 421

  Fly   213 TTSDGTEKGGYICDV---------CGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLRK 268
                       ||.:         ||.  |..|:.         :|.|  ..|:.:...:..:..
pombe   422 -----------ICRIPPETMASLYCGP--EADGKY---------VCLY--NGCNKRIARKYNVES 462

  Fly   269 HMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHE 326
            |:.:|...:||:|..|...|.....||.|..:|...:||||: |.|.|....:|.:|:
pombe   463 HIQTHLSDRPYRCDLCKAGFVRHHDLKRHLRIHENGRPYVCE-CLKRFNRLDALNRHK 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 12/64 (19%)
C2H2 Zn finger 225..245 CDD:275368 5/28 (18%)
COG5048 <250..369 CDD:227381 22/77 (29%)
C2H2 Zn finger 253..273 CDD:275368 2/19 (11%)
zf-H2C2_2 266..288 CDD:290200 6/21 (29%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 294..318 CDD:290200 11/23 (48%)
C2H2 Zn finger 309..329 CDD:275368 6/18 (33%)
C2H2 Zn finger 337..353 CDD:275368
ace2NP_594109.1 COG5048 45..518 CDD:227381 59/315 (19%)
C2H2 Zn finger 448..467 CDD:275368 2/18 (11%)
zf-C2H2 473..495 CDD:278523 7/21 (33%)
C2H2 Zn finger 475..495 CDD:275368 6/19 (32%)
zf-H2C2_2 487..511 CDD:290200 11/24 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.