DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Zif and lsl-1

DIOPT Version :9

Sequence 1:	NP_001189188.1	Gene:	Zif / 40795	FlyBaseID:	FBgn0037446	Length:	388	Species:	Drosophila melanogaster
Sequence 2:	NP_492621.2	Gene:	lsl-1 / 172844	WormBaseID:	WBGene00009937	Length:	318	Species:	Caenorhabditis elegans

Alignment Length:	78	Identity:	26/78 - (33%)
Similarity:	44/78 - (56%)	Gaps:	0/78 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   279 YKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKD 343
            ::|:.|::.|.....|:.|..:|...|||:|.||.:.|.|..::.:|..:|:....|.|.:|.|.
Worm    37 HQCNVCNKMFMNYKGLQQHSVIHTDTKPYICDVCGRGFRYKSNMFEHRTVHTGYTPYVCPFCGKQ 101

  Fly   344 FRLLHHMRQHEET 356
            |||..:|::|..|
Worm   102 FRLKGNMKKHMRT 114

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Zif	NP_001189188.1	zf-AD	9..87	CDD:285071
		C2H2 Zn finger	225..245	CDD:275368
		COG5048	<250..369	CDD:227381	26/78 (33%)
		C2H2 Zn finger	253..273	CDD:275368
		zf-H2C2_2	266..288	CDD:290200	2/8 (25%)
		C2H2 Zn finger	281..301	CDD:275368	5/19 (26%)
		zf-H2C2_2	294..318	CDD:290200	10/23 (43%)
		C2H2 Zn finger	309..329	CDD:275368	6/19 (32%)
		C2H2 Zn finger	337..353	CDD:275368	7/15 (47%)
lsl-1	NP_492621.2	COG5048	<26..160	CDD:227381	26/78 (33%)
		C2H2 Zn finger	39..59	CDD:275368	5/19 (26%)
		C2H2 Zn finger	67..87	CDD:275368	6/19 (32%)
		zf-C2H2	93..115	CDD:278523	10/22 (45%)
		C2H2 Zn finger	95..115	CDD:275368	9/20 (45%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C160156575
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930