| Sequence 1: | NP_001189188.1 | Gene: | Zif / 40795 | FlyBaseID: | FBgn0037446 | Length: | 388 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_848141.3 | Gene: | Zfp369 / 170936 | MGIID: | 2176229 | Length: | 845 | Species: | Mus musculus |
| Alignment Length: | 291 | Identity: | 73/291 - (25%) |
|---|---|---|---|
| Similarity: | 110/291 - (37%) | Gaps: | 61/291 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 125 GEEEHQEEKGHEEYLEVDTSDQQECIGDTIEYLEDNY---------------TIEMNSDQTEIVL 174
Fly 175 ESEKQYEETPSQQLA------------LQEAAK-------ASLK-----------ARRGRVRRGL 209
Fly 210 NSLTTSD---------GTEKGGYICDV--CGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVR 263
Fly 264 EQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELI 328
Fly 329 HSDIKLYRCDYCNKDF----RLLHHMRQHEE 355 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Zif | NP_001189188.1 | zf-AD | 9..87 | CDD:285071 | |
| C2H2 Zn finger | 225..245 | CDD:275368 | 4/21 (19%) | ||
| COG5048 | <250..369 | CDD:227381 | 39/110 (35%) | ||
| C2H2 Zn finger | 253..273 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 266..288 | CDD:290200 | 9/21 (43%) | ||
| C2H2 Zn finger | 281..301 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 294..318 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 309..329 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 337..353 | CDD:275368 | 6/19 (32%) | ||
| Zfp369 | NP_848141.3 | KRAB | 35..94 | CDD:214630 | |
| KRAB | 35..74 | CDD:279668 | |||
| SCAN | 179..266 | CDD:280241 | |||
| KRAB | 300..>340 | CDD:214630 | |||
| KRAB | 300..339 | CDD:279668 | |||
| C2H2 Zn finger | 676..695 | CDD:275370 | 1/18 (6%) | ||
| C2H2 Zn finger | 703..723 | CDD:275368 | 3/19 (16%) | ||
| zf-H2C2_2 | 715..740 | CDD:290200 | 7/24 (29%) | ||
| COG5048 | 727..>792 | CDD:227381 | 23/64 (36%) | ||
| C2H2 Zn finger | 731..751 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 743..767 | CDD:290200 | 9/23 (39%) | ||
| zf-C2H2 | 757..779 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 759..779 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2 | 785..807 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 787..807 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 799..824 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 815..835 | CDD:275368 | 6/19 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||