DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and Zscan5b

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_573467.2 Gene:Zscan5b / 170734 MGIID:2159640 Length:468 Species:Mus musculus


Alignment Length:434 Identity:105/434 - (24%)
Similarity:162/434 - (37%) Gaps:100/434 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SERLQRLDEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDG-------IC-------------- 60
            ||....:.::|     |.:|:..|.|   ..:||.:|.|.|.       ||              
Mouse    46 SEGSNWIQDLR-----SISELCYQWL---RPDLNSKEEILDQLVLEQFLICMPPEQQALVKESGV 102

  Fly    61 KSCK-----------------VELNMAYQFREKALRKQMEIEEYCRELGLLDESDVMMIKEEDGS 108
            ||||                 .....|:..|..::.|....|:   :.|..|.|...:..|.:.|
Mouse   103 KSCKDLEKLLRDRKRHNWSIIYSQGQAHLLRHPSVGKAEAAED---KWGHTDFSQEHLSNESEES 164

  Fly   109 --QQQCDEEMYILEET---TTGEEEH-----QEEKGHEEYLEVDTSDQQECIGDTIEYLEDNYTI 163
              :.|...|:..|.||   :|.:||.     ..|:...:||..:.|...:.:.| :|..|.:..:
Mouse   165 LNRGQASRELQNLSETEEPSTSQEEGILLGVIPERRQPDYLRPEMSPGSDSVPD-LEEAEASVFV 228

  Fly   164 EMN-----------------SDQTEIVLESEKQYEETPSQQLALQEAAKASLKARRGRVRRGLNS 211
            ..:                 ..|.:.|:::...:.....:.|||....: ||........:|:.|
Mouse   229 GQDPLPALGPAGSLGVKGAVQPQEDTVVDAVPSFTHILERDLALNRDLQ-SLSGFNLPTSQGVAS 292

  Fly   212 L--TTSDGTE--------------------KGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACE 254
            .  .|.||.|                    :..:.|..|...:..:.|...|:|.|.|...:.|.
Mouse   293 YMGNTEDGLEAANPEPANPQPEKQVDSLAGQARFQCTECKKSFLYKSRFDLHQRSHTGERPFKCI 357

  Fly   255 LCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYA 319
            ||:..|.....||.|...|||.|||.|..|..:|.:.|.|:.|..||...||:|||.|.:.|.:.
Mouse   358 LCNKAFVQSSDLRVHQRVHTGEKPYMCEVCGMEFAHGSTLQGHSRVHTKEKPFVCKDCGQRFCHK 422

  Fly   320 HSLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQHEETKLHQNAV 363
            .:|..|..||.:::.|.|..|||.||.....::|.:|.|.:..|
Mouse   423 GNLNVHFRIHCNLRPYVCKKCNKTFRQQGTWKRHMKTHLRKRKV 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 22/107 (21%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
COG5048 <250..369 CDD:227381 43/114 (38%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 266..288 CDD:290200 11/21 (52%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 294..318 CDD:290200 11/23 (48%)
C2H2 Zn finger 309..329 CDD:275368 6/19 (32%)
C2H2 Zn finger 337..353 CDD:275368 6/15 (40%)
Zscan5bNP_573467.2 SCAN 33..117 CDD:153421 18/78 (23%)
C2H2 Zn finger 328..348 CDD:275368 5/19 (26%)
zf-H2C2_2 344..365 CDD:372612 8/20 (40%)
C2H2 Zn finger 356..376 CDD:275368 7/19 (37%)
zf-H2C2_2 368..393 CDD:372612 12/24 (50%)
C2H2 Zn finger 384..404 CDD:275368 6/19 (32%)
zf-H2C2_2 397..419 CDD:372612 10/21 (48%)
zf-C2H2 410..432 CDD:333835 7/21 (33%)
C2H2 Zn finger 412..432 CDD:275368 6/19 (32%)
zf-C2H2 438..460 CDD:333835 8/21 (38%)
C2H2 Zn finger 440..460 CDD:275370 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.