DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and ZNF595

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_872330.1 Gene:ZNF595 / 152687 HGNCID:27196 Length:648 Species:Homo sapiens


Alignment Length:383 Identity:101/383 - (26%)
Similarity:154/383 - (40%) Gaps:81/383 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PQTCRVCLAQSERLQRLDEIRE-EGEESPNEMLIQLLGVSY---SNLNDREHIPDG----ICKSC 63
            |.||..|.....|...|:|.:: ...|.|.:  .:..|.::   :.||:.:.|..|    .||.|
Human   227 PYTCEECGKAFRRSTVLNEHKKIHTGEKPYK--CEECGKAFTRSTTLNEHKKIHTGEKPYKCKEC 289

  Fly    64 KVELNMAYQFREKALRKQMEIEEY-----------CRELG-------LLDESDVMMIKEEDGSQQ 110
                       .||.|....:.|:           |:|.|       .|:|...:...|:..:.:
Human   290 -----------GKAFRWSTSLNEHKNIHTGEKPYKCKECGKAFRQSRSLNEHKNIHTGEKPYTCE 343

  Fly   111 QCDEEMYILEETTTGEEEHQEEKGHEEYLEVDTSDQQECIGDTIEYLEDNYTIEMNSDQTEIVLE 175
            :|.:..............|.|:|.::         .:|| |..       :|...:.::.:.:..
Human   344 KCGKAFNQSSSLIIHRSIHSEQKLYK---------CEEC-GKA-------FTWSSSLNKHKRIHT 391

  Fly   176 SEKQYEETPSQQLALQEAAKA----SLKARRGRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRG 236
            .||.|        ..:|..||    |..|:..|:..|          || .|.|:.||..:.:..
Human   392 GEKPY--------TCEECGKAFYRSSHLAKHKRIHTG----------EK-PYTCEECGKAFNQSS 437

  Fly   237 RMMEHRRRHDGICQYACELCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVH 301
            .::.|:|.|.|...|.||.|...|.....|.:|...|||.|||||..|.:.|.:.:.|..|:|:|
Human   438 TLILHKRIHSGQKPYKCEECGKAFTRSTTLNEHKKIHTGEKPYKCEECGKAFIWSASLNEHKNIH 502

  Fly   302 RGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQHEETKLH 359
            .|.|||.||.|.|||..:..|..|..|||:.|||:|:.|.|.|.....:.:|:  |:|
Human   503 TGEKPYKCKECGKAFNQSSGLIIHRSIHSEQKLYKCEECGKAFTRSTALNEHK--KIH 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 19/85 (22%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
COG5048 <250..369 CDD:227381 46/110 (42%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 266..288 CDD:290200 11/21 (52%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 294..318 CDD:290200 14/23 (61%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
C2H2 Zn finger 337..353 CDD:275368 4/15 (27%)
ZNF595NP_872330.1 KRAB 4..64 CDD:214630
C2H2 Zn finger 147..167 CDD:275368
C2H2 Zn finger 175..194 CDD:275368
COG5048 198..599 CDD:227381 101/383 (26%)
C2H2 Zn finger 202..222 CDD:275368
C2H2 Zn finger 230..250 CDD:275368 5/19 (26%)
C2H2 Zn finger 258..278 CDD:275368 3/19 (16%)
C2H2 Zn finger 286..306 CDD:275368 7/30 (23%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..362 CDD:275368 1/19 (5%)
C2H2 Zn finger 370..390 CDD:275368 4/27 (15%)
C2H2 Zn finger 398..418 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..446 CDD:275368 5/19 (26%)
C2H2 Zn finger 454..474 CDD:275368 6/19 (32%)
C2H2 Zn finger 482..502 CDD:275368 6/19 (32%)
C2H2 Zn finger 510..530 CDD:275368 8/19 (42%)
C2H2 Zn finger 538..558 CDD:275368 6/21 (29%)
C2H2 Zn finger 566..586 CDD:275368
C2H2 Zn finger 594..614 CDD:275368
C2H2 Zn finger 622..642 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.