DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and ZNF730

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_016881603.1 Gene:ZNF730 / 100129543 HGNCID:32470 Length:514 Species:Homo sapiens


Alignment Length:359 Identity:89/359 - (24%)
Similarity:133/359 - (37%) Gaps:98/359 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CKSC-KVELNMAYQFREKAL---RKQMEIEEY---------CRELGLLDESDVMMIKEEDGSQQQ 111
            ||.| |:...:::..:.|.:   .|..:.|||         |.....:.|......||       
Human   186 CKECGKLFCILSHLAQHKKIHTGEKSYKCEEYGKAFNESSNCTTHKRITEKKPYKCKE------- 243

  Fly   112 CDEEMYILEETTTGEEEHQEEKGHE---------------EYLEVDTSDQ----QECIGDTIEYL 157
            |.:........||.:..|..||.::               .:..:.|.::    :|| |...   
Human   244 CGKAFNWFSHFTTHKRIHTGEKPYQCEKCGKFFNQSTNLTTHKRIHTGEKPYKCEEC-GKAF--- 304

  Fly   158 EDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEAAKA----SLKARRGRVRRGLNSLTTSDGT 218
                      :|:..:.|.:|.:  |..|....::..||    |...:..|:..|          
Human   305 ----------NQSSNLTEHKKIH--TKEQPYKCEKCGKAFKWSSTLTKHKRIHNG---------- 347

  Fly   219 EKGGYICDVCGNFYEKRGRMMEHRRRHDG-------ICQ---------------------YACEL 255
            || .|.|:.||..:.:...:..|:..|.|       .|.                     |.||.
Human   348 EK-PYKCEECGKAFNRSSTLNRHKITHTGGKPYKYKECGKAFNQSSTLTIHKIIHTVEKFYKCEE 411

  Fly   256 CDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAH 320
            |...|.....|..|...|||.|||||..|.|.|...|.|.:|:.:|.|.|||.|:.|.|||..:.
Human   412 CGKAFSRISHLTTHKRIHTGEKPYKCEECGRAFNQSSTLTTHKRIHTGEKPYECEECGKAFNRSS 476

  Fly   321 SLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQHE 354
            :||.|::|||..|:|:|..|.|.||...|:.:|:
Human   477 TLTTHKIIHSGEKIYKCKECGKAFRRFSHLTRHK 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 7/30 (23%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
COG5048 <250..369 CDD:227381 46/126 (37%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 266..288 CDD:290200 12/21 (57%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
zf-H2C2_2 294..318 CDD:290200 12/23 (52%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
C2H2 Zn finger 337..353 CDD:275368 6/15 (40%)
ZNF730XP_016881603.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.