DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zif and ZSCAN30

DIOPT Version :9

Sequence 1:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001106205.1 Gene:ZSCAN30 / 100101467 HGNCID:33517 Length:494 Species:Homo sapiens


Alignment Length:415 Identity:108/415 - (26%)
Similarity:159/415 - (38%) Gaps:98/415 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ELTPQTCRVCLAQSERLQR-LDEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKS----- 62
            |..|:.....:...|.|:: |:|.|::......||..|            |....|..||     
Human   110 EHRPENGEEAVTMLEELEKELEEPRQQDTTHGQEMFWQ------------EMTSTGALKSLSLNS 162

  Fly    63 --------CKVELNMAYQFRE--------KALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQQQ 111
                    ||.|...:..|:|        |.|..:.||.|......::...   .:..|..||: 
Human   163 PVQPLENQCKTETQESQAFQERDGRMVAGKVLMAKQEIVECVASAAMISPG---KLPGETHSQR- 223

  Fly   112 CDEEMYILEETTTGEEEHQEEKGH---EEYLEVDTSDQQECIG----------DTIEYLEDNYTI 163
                  |.||...|.:..:::||:   .:..::.:.|:...:.          ..:|..|...:.
Human   224 ------IAEEALGGLDNSKKQKGNAAGNKISQLPSQDRHFSLATFNRRIPTEHSVLESHESEGSF 282

  Fly   164 EMNS-DQTEIVLES-EKQYE--------------------ETPSQQLALQEAAKA-SLKA---RR 202
            .||| |.|:..::: ||.||                    .|..:..|.:|..|| ||.:   |.
Human   283 SMNSNDITQQSVDTREKLYECFDCGKAFCQSSKLIRHQRIHTGERPYACKECGKAFSLSSDLVRH 347

  Fly   203 GRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLR 267
            .|:..|          || .|.|..||..:.....::.|||.|.|...|.|..|...|.....|.
Human   348 QRIHSG----------EK-PYECCECGKAFRGSSELIRHRRIHTGEKPYECGECGKAFSRSSALI 401

  Fly   268 KHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDI 332
            :|...|||.|.|:|..|.:.|...|:|..|:.:|.|.|||.|..|.|:|..:.:||:|:.||:..
Human   402 QHKKIHTGDKSYECIACGKAFGRSSILIEHQRIHTGEKPYECNECGKSFNQSSALTQHQRIHTGE 466

  Fly   333 KLYRCDYCNKDFR----LLHHMRQH 353
            |.|.|..|.|.||    |:.|.|.|
Human   467 KPYECSECRKTFRHRSGLMQHQRTH 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 21/99 (21%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
COG5048 <250..369 CDD:227381 42/108 (39%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
zf-H2C2_2 266..288 CDD:290200 9/21 (43%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 294..318 CDD:290200 11/23 (48%)
C2H2 Zn finger 309..329 CDD:275368 7/19 (37%)
C2H2 Zn finger 337..353 CDD:275368 8/19 (42%)
ZSCAN30NP_001106205.1 SCAN 44..154 CDD:128708 11/55 (20%)
SCAN 44..122 CDD:280241 2/11 (18%)
COG5048 281..>360 CDD:227381 22/89 (25%)
zf-C2H2 301..323 CDD:278523 2/21 (10%)
C2H2 Zn finger 303..323 CDD:275368 0/19 (0%)
zf-H2C2_2 316..339 CDD:290200 5/22 (23%)
COG5048 <328..479 CDD:227381 56/161 (35%)
C2H2 Zn finger 331..351 CDD:275368 7/19 (37%)
zf-H2C2_2 343..366 CDD:290200 9/33 (27%)
C2H2 Zn finger 359..379 CDD:275368 6/19 (32%)
zf-H2C2_2 371..396 CDD:290200 9/24 (38%)
C2H2 Zn finger 387..407 CDD:275368 5/19 (26%)
zf-H2C2_2 399..424 CDD:290200 10/24 (42%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-H2C2_2 428..452 CDD:290200 11/23 (48%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
zf-H2C2_2 455..480 CDD:290200 11/24 (46%)
C2H2 Zn finger 471..491 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.