DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9727 and RFX2

DIOPT Version :9

Sequence 1:NP_001262317.1 Gene:CG9727 / 40794 FlyBaseID:FBgn0037445 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_000626.2 Gene:RFX2 / 5990 HGNCID:9983 Length:723 Species:Homo sapiens


Alignment Length:451 Identity:103/451 - (22%)
Similarity:156/451 - (34%) Gaps:153/451 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEKHGQLGAQWTKSAA--PAATTAPVSNSIPIPQPIPVALPLQKPNANPYGNCSLQPADIVYSA 63
            |....|  ||....|.|  |:|...||..|   ||.:.|    |..::||.|             
Human     1 MQNSEG--GADSPASVALRPSAAAPPVPAS---PQRVLV----QAASSNPKG------------- 43

  Fly    64 TRFQGPAIHAKGSPLTITPVGPVGGAPASAQISPTSHTHVPVPVATPSGFVPPPFSNATSASGGV 128
                     |:..|:::..|..|     ..|:.|..|.: |..|....|      .:|...:|.:
Human    44 ---------AQMQPISLPRVQQV-----PQQVQPVQHVY-PAQVQYVEG------GDAVYTNGAI 87

  Fly   129 STS-VLTPNPFATASANAAGLAFANAFSFSTAQQLGLGKIMHAMGGATAGVPSAPVPVTTTPATA 192
            .|: ...|.|...|.::.|                   ....|.|||...|             |
Human    88 RTAYTYNPEPQMYAPSSTA-------------------SYFEAPGGAQVTV-------------A 120

  Fly   193 APSTPTIAGPRHPNEGVP---AASGVINSTIAENVMNALSNSNSAGSVPSEEKMRRVLQVIETSL 254
            |.|.|.:  |.|...|:.   ..|.:::|..|..:...:.::..:.:..|......:...||   
Human   121 ASSPPAV--PSHSMVGITMDVGGSPIVSSAGAYLIHGGMDSTRHSLAHTSRSSPATLEMAIE--- 180

  Fly   255 DDNAKLQISQ-ILERVSGLKPIEKLFLYLRLPGECADTDPLRQPQNPLGTRSEINHTINWVRSHL 318
                .||.|: |....|||                                  :|..:.|:..:.
Human   181 ----NLQKSEGITSHKSGL----------------------------------LNSHLQWLLDNY 207

  Fly   319 EHDAQVSIPKQDVYNDYIAYCERLSIKPLSTADFGKVMKQVFPGVRPRRLGTRGNSRY------- 376
            |....||:|:..:||.|:.:|:...:.|::.|.|||:::.||.|:|.|||||||||:|       
Human   208 ETAEGVSLPRSSLYNHYLRHCQEHKLDPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGIRL 272

  Fly   377 -------------CYAAMRKTTKLTPPQLPQLCKTEQIVAGDS------NSDPSQLTSASS 418
                         .|.|||:......|:.....||:.:  |||      :|.|.|..:..|
Human   273 KPDSPLNRLQEDTQYMAMRQQPMHQKPRYRPAQKTDSL--GDSGSHSGLHSTPEQTMAVQS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9727NP_001262317.1 RFX_DNA_binding 307..383 CDD:280427 32/95 (34%)
RFX2NP_000626.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 19/75 (25%)
RFX1_trans_act 30..153 CDD:282451 38/194 (20%)
RFX_DNA_binding 200..272 CDD:280427 28/71 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..332 10/42 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 688..723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346630at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.