DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9727 and Rfx4

DIOPT Version :9

Sequence 1:NP_001262317.1 Gene:CG9727 / 40794 FlyBaseID:FBgn0037445 Length:1329 Species:Drosophila melanogaster
Sequence 2:XP_038936002.1 Gene:Rfx4 / 500818 RGDID:1562092 Length:757 Species:Rattus norvegicus


Alignment Length:681 Identity:131/681 - (19%)
Similarity:222/681 - (32%) Gaps:226/681 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 TINWVRSHLEHDAQVSIPKQDVYNDYIAYCERLSIKPLSTADFGKVMKQVFPGVRPRRLGTRGNS 374
            |:.|:..:.|....|.||:..:|..|:.:||:...:|::.|.|||:::|.||.:..|||||||.|
  Rat    83 TLQWLEENYEIAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLGTRGQS 147

  Fly   375 RYCY--------------------------AAMRKTTKLT------------------------P 389
            :|.|                          ...|:.||.|                        |
  Rat   148 KYHYYGIAVKESSQYYDVMYSKKGAAWVSETGKREVTKQTVAYSPRSKLGTLLPDFPNVKDLNLP 212

  Fly   390 PQLPQ------------LCKTEQIVAGDSNSDPSQLTSASSLGGLP----STGGDSECWDVV--- 435
            ..||:            .|:........:|.|..|........|:|    ...|.|...::|   
  Rat   213 ASLPEEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVC 277

  Fly   436 -----RSWAEKLLNTKLESVADLSSRIKSNNATVSTKKYTPREPKEKRV-LADIG--------PL 486
                 ::.:..|:.|.|:::.|        :.|...:|:..:..:..:| |.|:.        .|
  Rat   278 DSILYKAISGVLMPTVLQALPD--------SLTQVIRKFAKQLDEWLKVALHDLPENLRNIKFEL 334

  Fly   487 KKRRKKKRKGSTSSESSCN------------------------QLVTGQDAGSSQEASDEQ---I 524
            .:|..:..:..||....|.                        ..:|.|...:.:::.||.   |
  Rat   335 SRRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDWRNVDLSSITKQTLYTMEDSRDEHRRLI 399

  Fly   525 LKIKQEIIDSPIHPQQPPIGYLQQVTPM------NLATDQRSSSAVRNLTPKILEMGS---PAVV 580
            :::.|| .|..:..|.|...|::.:..|      .:|..::.|  ::.:..:.|.|.|   ..|:
  Rat   400 IQLYQE-FDHLLEEQSPIESYIEWLDTMVDRCVVKVAAKRQGS--LKKVAQQFLLMWSCFGTRVI 461

  Fly   581 --LTQQEVSPTG------IVIKDEVEDYTSNIFCK----KVLKAQQTKGFWANSPSSGTTSGVGL 633
              :|.......|      ::..|.|.....::.|:    ::::|.:.:|..|.:...        
  Rat   462 RDMTLHSAPSFGSFHLIHLMFDDYVLYLLESLHCQERANELMRAMKGEGSTAEAQEE-------- 518

  Fly   634 LVPPTITTTSATPPPPNSETSPVPGPGLSMGPPSQMMSTSSVSPSSTVDTTPK-----VASRNQM 693
                 |..|.||||.|:      |||..|   |::..::..|.|.|:..:.|.     :::...|
  Rat   519 -----IILTEATPPTPS------PGPSFS---PAKSATSVEVPPPSSPVSNPSPEYTGLSTTGAM 569

  Fly   694 MILRAKRLMAAENAALAAAEDS-GLP--ENLGLPRERVISICNMDKHELDDYFLPGEDEENSEEP 755
            .............||.:.||:| .||  .:..:|...|       .|.:..|      ....|..
  Rat   570 QSYTWSLTYTVTTAAGSPAENSQQLPCMRSTHVPSSSV-------THRIPVY------SHREEHG 621

  Fly   756 DNELLQYFQMGDAEEKQLNSLDAAEQNKNP--------------------------------QEP 788
            ......|...|:.....|       ||:.|                                .||
  Rat   622 YTGSYNYGSYGNQHPHPL-------QNQYPALPHDTAISGPLHYSPYHRSSAQYPFNSPTSRMEP 679

  Fly   789 PTMGSAPEAMPAP--GRGAAVVAAAAAMLAP 817
            ..|.|.|...|.|  .|...|..|.|...:|
  Rat   680 CLMSSTPRLHPTPVTPRWPEVPTANACYTSP 710

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9727NP_001262317.1 RFX_DNA_binding 307..383 CDD:280427 28/98 (29%)
Rfx4XP_038936002.1 RFX_DNA_binding 81..156 CDD:396712 28/72 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346630at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.