DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9727 and Rfx2

DIOPT Version :9

Sequence 1:NP_001262317.1 Gene:CG9727 / 40794 FlyBaseID:FBgn0037445 Length:1329 Species:Drosophila melanogaster
Sequence 2:XP_038939066.1 Gene:Rfx2 / 301121 RGDID:1588579 Length:784 Species:Rattus norvegicus


Alignment Length:415 Identity:97/415 - (23%)
Similarity:154/415 - (37%) Gaps:128/415 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IPVALPLQKPNANPYGNCSLQPADIVYSATRFQGPAIHAKGSP---LTITPVGPVGGAPASAQIS 96
            :|.....|:|  .|.......||::  .....|......||:|   ||:..|.||          
  Rat    72 LPTRSDTQRP--TPREPLPELPAEL--QRVLVQAAGSTPKGTPMQTLTLPRVQPV---------- 122

  Fly    97 PTSHTHV-PVPVATPSGFVPPPFSNATSASGGVSTS-VLTPNPFATASANAAGLAFANAFSFSTA 159
            |....|| |..|....|      .:|..|:|.:..: ...|:|...|.::||..       |.|.
  Rat   123 PPQVQHVYPAQVQYVEG------GDAVYANGAIRAAYTYNPDPQLYAPSSAASY-------FETP 174

  Fly   160 QQLGLGKIMHAMGGATAGVPSAPVPVTTTPATAAPSTPT--IAGPRHPNEGVPAASGVINSTIAE 222
                        |||.          .|..|::.|:.|:  :.|......|.|..||. .:.:..
  Rat   175 ------------GGAQ----------VTVAASSPPAVPSHGMVGITMDVSGTPIVSGA-GTYLIH 216

  Fly   223 NVMNALSNS--NSAGSVPSEEKMRRVLQVIETSLDDNAKLQISQILERVSGLKPIEKLFLYLRLP 285
            ..|::..:|  ::|.|.|:..:|     .|||             |::..||.|.:...|     
  Rat   217 GGMDSTRHSLAHTARSSPATLEM-----AIET-------------LQKSEGLAPHKGGLL----- 258

  Fly   286 GECADTDPLRQPQNPLGTRSEINHTINWVRSHLEHDAQVSIPKQDVYNDYIAYCERLSIKPLSTA 350
                                  |..:.|:..:.|....||:|:..:||.|:.:|:...::|::.|
  Rat   259 ----------------------NSHLQWLLDNYETAEGVSLPRSSLYNHYLRHCQEHKLEPVNAA 301

  Fly   351 DFGKVMKQVFPGVRPRRLGTRGNSRY--------------------CYAAMRKTTKLTPPQLPQL 395
            .|||:::.||.|:|.|||||||||:|                    .|.|||:......|:....
  Rat   302 SFGKLIRSVFMGLRTRRLGTRGNSKYHYYGIRLKPDSPLNRLQEDTQYMAMRQQPTHQKPRYRPA 366

  Fly   396 CKTEQIVAGDSNSD----PSQLTSA 416
            .|::.:..|.::|:    |.|..:|
  Rat   367 QKSDSLGDGSAHSNMHSTPEQAMAA 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9727NP_001262317.1 RFX_DNA_binding 307..383 CDD:280427 32/95 (34%)
Rfx2XP_038939066.1 RFX1_trans_act 73..215 CDD:398335 43/191 (23%)
RFX_DNA_binding 262..334 CDD:396712 28/71 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346630at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.