DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9727 and sak1

DIOPT Version :9

Sequence 1:NP_001262317.1 Gene:CG9727 / 40794 FlyBaseID:FBgn0037445 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_594086.1 Gene:sak1 / 2543421 PomBaseID:SPAC3G9.14 Length:766 Species:Schizosaccharomyces pombe


Alignment Length:505 Identity:94/505 - (18%)
Similarity:160/505 - (31%) Gaps:205/505 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 LERVSGLK---------PIEKLFLYLRLPGECADTDPLRQPQNPLGTRSEINHTINWVRSHLEHD 321
            ||:.:.||         .:|.|...||:....|:::..||.           ..|.|::...|..
pombe    59 LEQETELKRLALEHEHYSLESLAEKLRMDHVSANSEKFRQV-----------FGICWLKRACEEQ 112

  Fly   322 AQVSIPKQDVYNDYIAYCERLSIKPLSTADFGKVMKQVFPGVRPRRLGTRGNSRYCYAAMRKTTK 386
            ...::.:..:|..|:..|..|.||||::|.|||:::.:||.::.||||.||:|:|.|..::    
pombe   113 QDAAVQRNQIYAHYVEICNSLHIKPLNSASFGKLVRLLFPSIKTRRLGMRGHSKYHYCGIK---- 173

  Fly   387 LTPPQLPQLCKTEQIVAGDSNSDPSQLTSASSLGGLPSTGGDSECWDVVRSWAEKLLN---TKLE 448
                           :.|..:....:..|.|||..:..:           |:.:.:.|   ..:.
pombe   174 ---------------LRGQDSFRRLRTFSDSSLSPVSCS-----------SFPKPIPNHFENDVS 212

  Fly   449 SVADLSSRIKSNNATVSTKKYTPREPKEKRVLADIGPLKKRRKKKRKGSTSSESSCNQLVTGQDA 513
            |:.:.:.|::|:.|:|:.....                       ||.:.:..|           
pombe   213 SIQNTNQRVESSPASVNAAAIV-----------------------RKSAVTPSS----------- 243

  Fly   514 GSSQEASDEQILKIKQEIIDSPIHPQQPPIGYLQQVTPMNLATDQRSSSAVRNLTPKILEMGSPA 578
                                .|.:...|.|..|...|.:.||                     |:
pombe   244 --------------------DPYNSPPPSIPLLGSQTNLQLA---------------------PS 267

  Fly   579 VVLTQQEVSPTGIVIKDEVEDYTSNIFCKKVLKAQQTKGFWANSPSSGTTSGVGLLVPPTITTTS 643
            ....|....|:.:                              |.|:         |||.::.:|
pombe   268 FAAPQAHPLPSHL------------------------------SQSN---------VPPQLSHSS 293

  Fly   644 A-TPPPPNSETSPVPGPGLSMGPPSQMMSTSSVSPSSTVDTTPKVASRNQMMILRAKRLMAAENA 707
            . :|.||.|.:.|.     ....|....|:|.|..:|::..|...||                  
pombe   294 VPSPAPPRSVSQPT-----YFSQPMPQFSSSFVPGTSSIVPTLHPAS------------------ 335

  Fly   708 ALAAAEDSGLPENL-------GLPRERVISICNMDKHELD----DYFLPG 746
               |.||..|..:|       .||..::..|.::|.....    ||:|.|
pombe   336 ---AQEDFNLQHSLFFKLKLKFLPPHKLPWIPSLDVSSFSLPPIDYYLNG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9727NP_001262317.1 RFX_DNA_binding 307..383 CDD:280427 26/75 (35%)
sak1NP_594086.1 RFX_DNA_binding 98..174 CDD:280427 27/105 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.