DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9727 and Rfx1

DIOPT Version :9

Sequence 1:NP_001262317.1 Gene:CG9727 / 40794 FlyBaseID:FBgn0037445 Length:1329 Species:Drosophila melanogaster
Sequence 2:XP_011246631.1 Gene:Rfx1 / 19724 MGIID:105982 Length:1073 Species:Mus musculus


Alignment Length:586 Identity:117/586 - (19%)
Similarity:200/586 - (34%) Gaps:218/586 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SAAPAATTA-----PVSNSIPIPQPIPVALPLQKPNANPYGNCS---LQPADIVYSATRFQGPAI 71
            :..||||..     .|..|:|:.|...|.....:..|.|....:   |||..:...::..|.||.
Mouse   214 AGTPAATVQQLQVHSVQQSVPVTQERSVVQATPQTKAGPVQQLTVQGLQPVHVAQESSGSQFPAR 278

  Fly    72 HA-----KGSPLTITPVGPVGGAPA---------------------------------------- 91
            .|     :.:|....|..|.|..|.                                        
Mouse   279 KAEQQETRPTPPPEPPPRPPGPGPVCCGEVLQLGSEQQPLHYEPGVEQWVELVGMLPPHLLLPQQ 343

  Fly    92 ----------SAQISPTSHT---------------------HVPVP--VATPSGFVPPPFSNATS 123
                      ||:.||....                     .||||  .::...:|....::.|:
Mouse   344 RVVFEPQRGLSARASPDLRVRIHRMPQVLVFGTALKVQQLPQVPVPHVYSSQVQYVEGGDASYTA 408

  Fly   124 ASGGVSTSVLTPNPFATASA-----NAAGLAFANAFSFSTAQQLGLGKIMHAMGGATAGVPSAPV 183
            ::...||......|..|.:|     .|:|.| |...:.:|:|.:           |::|  |.|:
Mouse   409 SAIRSSTYQYPETPIYTQTAGTSYYEASGTA-AQVSTPATSQTV-----------ASSG--SVPM 459

  Fly   184 PVTTTPATAAPSTPTIAGPRHPNEGVPAASGVINSTIAE--NVMNALSNSNSAGSVPSEEKMRRV 246
            .|:.:|..|:.|:              :.:|..||::..  |.....|...|.||..|.      
Mouse   460 YVSGSPIVASSSS--------------SEAGASNSSVGAGGNGGGGSSGGGSGGSSGSG------ 504

  Fly   247 LQVIETSLDDNAKLQISQILERVSGLKPIEKLFLYLRLPGECADTDPLRQPQNPLGTRSE-INH- 309
                                   :|...|:..::                    ||..|: .:| 
Mouse   505 -----------------------AGTYVIQGGYM--------------------LGNASQSYSHT 526

  Fly   310 ------TINWVRSHLEHDAQVSIPKQDVYNDYIAYCERLSIKPLSTADFGKVMKQVFPGVRPRRL 368
                  |:.|:..:.|....||:|:..:|..|:.:|:...::|::.|.|||:::.||.|:|.|||
Mouse   527 TRASPATVQWLLDNYETAEGVSLPRSTLYCHYLLHCQEQKLEPVNAASFGKLIRSVFMGLRTRRL 591

  Fly   369 GTRGNSRYCYAAMRKTTKLTPPQLPQLCKTEQIVA--GDSNSDPSQLTSASSLGGL--------P 423
            ||||||:|.|..:|  .|.:.|.| :|.:.:|.:|  |...|...:|.....:.|:        .
Mouse   592 GTRGNSKYHYYGLR--IKASSPLL-RLMEDQQHMAMRGQPFSQKQRLKPIQKMEGVANGVAVGQQ 653

  Fly   424 STGGDSECWDVVRSWAEKLLNTKLESVADLSSRIKSNNATVSTKKYTPREPK---EKRVLAD-IG 484
            |||                       ::|:|::::.....:...:..|...:   :.:||.: :|
Mouse   654 STG-----------------------LSDISAQVQQYQQFLDASRSLPDFAELDLQGKVLPEGVG 695

  Fly   485 P 485
            |
Mouse   696 P 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9727NP_001262317.1 RFX_DNA_binding 307..383 CDD:280427 30/82 (37%)
Rfx1XP_011246631.1 RFX1_trans_act 209..467 CDD:398335 50/266 (19%)
RFX_DNA_binding 531..606 CDD:396712 30/76 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346630at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.