DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gpp and dot-1.5

DIOPT Version :9

Sequence 1:NP_731085.2 Gene:gpp / 40793 FlyBaseID:FBgn0264495 Length:2137 Species:Drosophila melanogaster
Sequence 2:NP_508351.2 Gene:dot-1.5 / 191070 WormBaseID:WBGene00022512 Length:361 Species:Caenorhabditis elegans


Alignment Length:216 Identity:71/216 - (32%)
Similarity:103/216 - (47%) Gaps:6/216 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 RHILQLVY---NAAVLDPDKLNQYEPFSPEVYGETSYELVQQMLKHVTVSKEDTFIDLGSGVGQV 175
            :|..::.|   ..::.|...||.|.|.|.|.||||:...:..:.:.:.|..:|.|.||||||||.
 Worm   134 KHASRICYFSRELSIGDEKLLNNYRPHSAETYGETALNQLLSICEELEVGTDDIFADLGSGVGQT 198

  Fly   176 VLQMAGSFPLKTCIGIEKADTPARYAERMDVIFRQYMGWFGKRFCEYKLIKGDFLVDEHRENITS 240
            ||.::....:|..||.|....|::.||.....|...|...||...|.|||.|.||..|..|.|||
 Worm   199 VLFLSAFAGVKKSIGFEIMQYPSKCAELNRSHFISLMKHLGKAPLEIKLIHGSFLDAEAVELITS 263

  Fly   241 -STLVFVNNFAFGPTVDHQLKERFADLRDGARVVSSKSFCPLNFRITDRN--LSDIGTIMHVSEI 302
             :||:|:||..|.|.:....:..|...:.|.|::|:..|..........|  .|.:.:|....::
 Worm   264 EATLLFMNNVKFDPPLMLNSENLFKKCKVGTRIISTSEFVNRGRSPEASNAWTSQLASITSTKKL 328

  Fly   303 PPLKGSVSWTCKPVSYYLHVI 323
            ..:..:||||.....:||..|
 Worm   329 RSVSNNVSWTGLTQQFYLTTI 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gppNP_731085.2 DOT1 121..323 CDD:149273 69/207 (33%)
dot-1.5NP_508351.2 AdoMet_MTases 150..349 CDD:302624 68/198 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3924
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5493
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D55132at33208
OrthoFinder 1 1.000 - - FOG0003132
OrthoInspector 1 1.000 - - otm14488
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21451
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.