DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gpp and D1053.2

DIOPT Version :9

Sequence 1:NP_731085.2 Gene:gpp / 40793 FlyBaseID:FBgn0264495 Length:2137 Species:Drosophila melanogaster
Sequence 2:NP_509963.2 Gene:D1053.2 / 183912 WormBaseID:WBGene00008367 Length:154 Species:Caenorhabditis elegans


Alignment Length:114 Identity:36/114 - (31%)
Similarity:57/114 - (50%) Gaps:3/114 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 WFGKRFCEYKLIKGDFLVDEHRENITSSTLVFVNNFAFGPTVDHQLKERFADLRDGARVVSSKSF 278
            :|.....|.:.:|. :|||...|..|.:|::.|||..|.|.:..:|||..:...||.|::||:|.
 Worm    40 FFNLNDVETRSLKA-YLVDRINEIQTQATVIVVNNVRFSPELKLELKEILSKCIDGTRIISSESI 103

  Fly   279 C--PLNFRITDRNLSDIGTIMHVSEIPPLKGSVSWTCKPVSYYLHVIDR 325
            .  |.:...|.|.:.|...|.....:..::.:.|||...|.:||..|:|
 Worm   104 VPRPRSQSSTSRRIDDFVKITDERLLHLVENNTSWTGDKVPFYLTEINR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gppNP_731085.2 DOT1 121..323 CDD:149273 34/110 (31%)
D1053.2NP_509963.2 AdoMet_MTases <57..150 CDD:302624 29/92 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156810
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3924
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5493
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D55132at33208
OrthoFinder 1 1.000 - - FOG0003132
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.700

Return to query results.
Submit another query.