DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dmtn and Tex28

DIOPT Version :9

Sequence 1:NP_001163531.1 Gene:Dmtn / 40792 FlyBaseID:FBgn0037443 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001178032.1 Gene:Tex28 / 690282 RGDID:1582832 Length:409 Species:Rattus norvegicus


Alignment Length:465 Identity:105/465 - (22%)
Similarity:198/465 - (42%) Gaps:115/465 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 SGNEDYYSSFVSDEFDSSKKVHRRCHERSSSVQAIDRLNTKIQCTKESIRQEQTARDDNVNEYLK 283
            |.:||..||..|   .|..::.|...|         .:..:|....|.:|.|:.:||:|...|||
  Rat    27 SSHEDCPSSHTS---FSDGELARNVRE---------GVKHRIFYLSEQLRVEKASRDENTMSYLK 79

  Fly   284 LAASADKQQLQRIKAVFEKKNQKSAHNISQLQKKLDNYTKRAKDLQNHQFQTKSQHRQPREVLRD 348
            |.:.||:.|...|:..||:.||:::..|:.:::||....::.|:|:        :...|..::.:
  Rat    80 LISKADRHQAPHIRKAFERVNQRTSATIAHIERKLYQCHQQLKELE--------EGCSPTSLVLN 136

  Fly   349 VGQGL---RNVGGNIRDGITGFSGSVMSKPREFAHLIKNKFGSADNINQMS--EAELQGMQSANA 408
            |..|:   :..||.|       ..|.:|||       ..:.....|:.:.|  |:.|.|||..  
  Rat   137 VDSGMDSHKQPGGKI-------LYSKLSKP-------DGEDSLPINVARSSTLESHLPGMQQR-- 185

  Fly   409 DVLGSERLQQVPGAGTSTGSGGGGQNNNTGGAGSGTGKFNSDNGSECSSVTSESIPGGSGKSQSG 473
                                                 ||:.                    .:..
  Rat   186 -------------------------------------KFSD--------------------KKYV 193

  Fly   474 ASQYHIVLKTLLTELAERKAENEKLKERIERL-ETGQKEFNNLTATLESERYRAEGLEEQINDLT 537
            |.|..::|:.:..||.|.|..:..|:...:.| |:...:...:..:|:.::.|...:||.:||..
  Rat   194 AQQQKLLLQKMKEELTEAKKVHASLQLSHQNLKESHMIDVRRILESLQEKKTRQSLMEEHVNDHL 258

  Fly   538 ELHQNEIENLKQTIADMEEKVQYQSDERLRDVNEVLENCQTRISKMEHMSQQQYVTVEGIDNSNA 602
            :.:.:||.:|||.:|..|||:.|.|.||.:::.:|:|..:.||:|:|.:.|...:.:.....:..
  Rat   259 QRYLDEICHLKQHLACTEEKMAYLSYERAKEIWDVMETFKNRITKLETLQQATQLEMMASLRTRP 323

  Fly   603 RALVVKLINVVLTILQVVLLLVATAAGIIMPFLKTRVRVLTTFLSICFVIFVIRQWPDVQDIGSG 667
            :....:.|:::||:..::|::|:|.....:|.|.:|:|:        |::|:|        ||.|
  Rat   324 KDFFFRFISLLLTLTTILLVVVSTLCSCPLPLLNSRLRI--------FIVFMI--------IGLG 372

  Fly   668 LVRHLKQSLV 677
            .:...|:.::
  Rat   373 TLAWQKRHVI 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DmtnNP_001163531.1 Tmemb_cc2 253..658 CDD:287269 92/410 (22%)
Tex28NP_001178032.1 Tmemb_cc2 50..377 CDD:402057 96/432 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334418
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR17613
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.