DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and AT1G68070

DIOPT Version :10

Sequence 1:NP_649653.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_176974.1 Gene:AT1G68070 / 843135 AraportID:AT1G68070 Length:343 Species:Arabidopsis thaliana


Alignment Length:134 Identity:34/134 - (25%)
Similarity:53/134 - (39%) Gaps:37/134 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 LIGM---CFIIMVIYMIYKCIREQRRLRRHRLPKSMLKKLPVLRY-TKNNANNKYD--------- 233
            |||:   |.:..:|.::|....::      ...::.|..||..|: |.||...:.|         
plant   215 LIGIALCCCLPCIIALLYAVAGQE------GASEADLSILPKYRFHTMNNDEKQSDGGGKMIPVD 273

  Fly   234 -----------------TCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPICKRKVF 281
                             .|.|||..:.:..:|..|||:|.:|:.||..||..| ..||:||..:.
plant   274 AASENLGNERVLLPEDADCCICLSSYEDGAELVSLPCNHHFHSTCIVKWLKMN-ATCPLCKFNIL 337

  Fly   282 TKGE 285
            ...|
plant   338 KGNE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_649653.1 PA_C_RZF_like 14..171 CDD:239038
RING-H2_RNF13-like 233..278 CDD:438327 19/70 (27%)
AT1G68070NP_176974.1 RING-H2_PA-TM-RING 291..333 CDD:438118 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.