DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and AT1G53010

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_175709.1 Gene:AT1G53010 / 841734 AraportID:AT1G53010 Length:178 Species:Arabidopsis thaliana


Alignment Length:166 Identity:45/166 - (27%)
Similarity:66/166 - (39%) Gaps:69/166 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 ILPFSILIGMCF----------IIMVIYMIYKCI------------------REQRRLR---RH- 208
            :|..::.||:|.          :|:|||:|..||                  |.|:|.|   .| 
plant    14 VLGLAVFIGLCILLVVLIATSALILVIYVIIDCILRPFLGTCLDLDLEIGVQRGQQRARIVTYHT 78

  Fly   209 ------RLP----------------KSMLKKLPVLRYTKNNANNKYD--------TCVICLEDFI 243
                  |||                :::|.||.|     ...|::.|        .|.|||..::
plant    79 IISTGLRLPDFEREGKKRGLKQSVIETLLPKLLV-----GQGNHEEDEEKSLESRECAICLSGYV 138

  Fly   244 EDDKLRVLP-CSHPYHTHCIDPWLTENRRVCPICKR 278
            .:::.||.| |.|.||..|||.|| :|...||.|::
plant   139 VNEECRVFPVCRHIYHALCIDAWL-KNHLTCPTCRK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038
zf-RING_2 233..277 CDD:290367 20/52 (38%)
AT1G53010NP_175709.1 RING_Ubox 129..172 CDD:418438 19/43 (44%)
RING-H2 finger (C3H2C3-type) 130..171 CDD:319361 19/41 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.