DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gzl and AT1G04790

DIOPT Version :9

Sequence 1:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_563717.1 Gene:AT1G04790 / 839412 AraportID:AT1G04790 Length:634 Species:Arabidopsis thaliana


Alignment Length:209 Identity:54/209 - (25%)
Similarity:78/209 - (37%) Gaps:58/209 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PPHLKYPPSAKFVALVARGECV----FERKIRVAQNASYSAVIVYNNEGDDLEQMSAENITGIRI 138
            ||..:.|     |...|||...    ....:|.|.|.|:...:..::..|.||::  ||..|..|
plant   477 PPQARAP-----VRAPARGRGYRLGGASASLRTALNFSFPIDMGLDSRMDILEEL--ENAIGHSI 534

  Fly   139 PSVFVGHTTGKALATYFTTE--VVLIINDELPFNINTQLILPFSILIGMCFIIMVIYMIYKCIRE 201
            .|..:.|     :...||.:  .:|:..||                                   
plant   535 TSSNLLH-----MDRDFTEDDYELLLALDE----------------------------------- 559

  Fly   202 QRRLRRHRLPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWL 266
                ..||...:...::..|..:....:|..:|||||||.....|.:|.|||.|.:|..||||||
plant   560 ----NNHRHGGASANRINNLPESTVQTDNFQETCVICLETPKIGDTIRHLPCLHKFHKDCIDPWL 620

  Fly   267 TENRRVCPICKRKV 280
            ..::. ||:||..|
plant   621 GRSKS-CPVCKSSV 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 25/98 (26%)
zf-RING_2 233..277 CDD:290367 22/43 (51%)
AT1G04790NP_563717.1 RILP-like <391..431 CDD:304877
zf-RING_2 587..630 CDD:290367 22/43 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.